Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7369
Gene name
Locationscaffold_704:8039..9216
Strand-
Gene length (bp)1177
Transcript length (bp)1077
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.6E-22 1 311
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-14 3 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 1 357 7.0E-73
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 1 344 1.0E-14
sp|P94131|MUCK_ACIAD Cis,cis-muconate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mucK PE=3 SV=1 1 251 8.0E-14
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 1 325 1.0E-13
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 1 322 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 1 357 7.0E-73
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 1 344 1.0E-14
sp|P94131|MUCK_ACIAD Cis,cis-muconate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mucK PE=3 SV=1 1 251 8.0E-14
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 1 325 1.0E-13
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 1 322 1.0E-12
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 1 322 1.0E-12
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 1 322 3.0E-12
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 1 322 5.0E-12
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 1 322 6.0E-12
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 1 303 1.0E-08
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 1 325 1.0E-07
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 2 321 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 56 75 19
2 115 134 19
3 154 176 22
4 183 202 19
5 284 303 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7369
MGGLYGNAAATALEDCPHEARGLMSGILQQGYAFGYLLCAAFARGLVNTTPYGWRPLFWFAACPPVLFILWRLVL
PETASYRERQRLRVEAGPSQHRSATSTFLVEAKVALSRHWLLLTYMVLLMAGFNFMSHGSQDLYPTMLDNQLGFS
PTDVTVTQIVANLGAMLGGTVVGFCSQSVGRRFSIVVCCVVGGALLYPYGFVRSTSIMAAAFFEQFCVQGAWGVI
PIHLMELSPGALRTFVVGTSYQLGNLVSSASSTIEARLGERFPLPSTTEGVKRYDYGKVMSIFMACVYLYVLLLT
FVGPENLRRSFDIEHDDDADAVVGRDAVERAAAAGRSHGSEKARLDEDEKKKEESIEA
Coding >Ophio5|7369
ATGGGTGGCCTCTACGGCAACGCTGCCGCCACCGCGCTGGAAGATTGTCCTCATGAGGCTCGTGGCTTGATGAGC
GGCATCCTCCAGCAAGGGTACGCCTTCGGATATCTTCTCTGCGCCGCCTTCGCCCGTGGCCTCGTCAACACAACC
CCTTACGGCTGGCGACCACTCTTCTGGTTCGCCGCCTGTCCGCCCGTCCTCTTCATCCTCTGGCGTCTCGTCCTC
CCCGAAACGGCCAGCTACCGTGAACGGCAACGGTTACGGGTCGAGGCTGGTCCGAGCCAGCACCGATCCGCCACT
TCGACTTTCTTGGTCGAGGCCAAAGTCGCGCTGAGCCGGCATTGGCTTCTCTTGACGTACATGGTGCTTCTCATG
GCCGGCTTCAACTTTATGAGCCATGGCAGTCAGGATCTGTACCCGACCATGTTGGACAATCAGCTCGGCTTTTCT
CCTACCGACGTCACCGTCACCCAGATCGTGGCCAATCTGGGTGCCATGCTTGGAGGCACCGTCGTCGGCTTCTGC
AGCCAGTCTGTCGGTCGACGCTTCAGCATCGTCGTCTGCTGCGTCGTAGGAGGCGCCCTGCTCTACCCTTATGGC
TTCGTCCGGTCAACCTCCATCATGGCAGCCGCCTTCTTCGAGCAGTTCTGCGTTCAGGGAGCATGGGGTGTGATC
CCCATACACCTCATGGAGTTATCTCCGGGAGCACTGCGCACCTTCGTCGTCGGTACGTCCTATCAGCTCGGCAAT
CTCGTCTCTTCGGCCTCGTCTACCATCGAGGCCCGTCTCGGCGAACGGTTTCCCCTTCCGTCTACCACCGAGGGT
GTGAAGAGGTACGATTACGGAAAGGTCATGTCCATCTTCATGGCTTGCGTCTATCTCTACGTCTTACTCCTGACC
TTTGTCGGACCGGAGAATTTGCGCCGCAGCTTCGATATCGAGCACGATGACGATGCTGACGCTGTCGTCGGCCGG
GATGCTGTTGAGCGGGCGGCGGCGGCGGGGAGGAGTCATGGAAGTGAAAAGGCGAGGCTGGATGAGGACGAGAAG
AAGAAGGAGGAGTCGATTGAAGCC
Transcript >Ophio5|7369
ATGGGTGGCCTCTACGGCAACGCTGCCGCCACCGCGCTGGAAGATTGTCCTCATGAGGCTCGTGGCTTGATGAGC
GGCATCCTCCAGCAAGGGTACGCCTTCGGATATCTTCTCTGCGCCGCCTTCGCCCGTGGCCTCGTCAACACAACC
CCTTACGGCTGGCGACCACTCTTCTGGTTCGCCGCCTGTCCGCCCGTCCTCTTCATCCTCTGGCGTCTCGTCCTC
CCCGAAACGGCCAGCTACCGTGAACGGCAACGGTTACGGGTCGAGGCTGGTCCGAGCCAGCACCGATCCGCCACT
TCGACTTTCTTGGTCGAGGCCAAAGTCGCGCTGAGCCGGCATTGGCTTCTCTTGACGTACATGGTGCTTCTCATG
GCCGGCTTCAACTTTATGAGCCATGGCAGTCAGGATCTGTACCCGACCATGTTGGACAATCAGCTCGGCTTTTCT
CCTACCGACGTCACCGTCACCCAGATCGTGGCCAATCTGGGTGCCATGCTTGGAGGCACCGTCGTCGGCTTCTGC
AGCCAGTCTGTCGGTCGACGCTTCAGCATCGTCGTCTGCTGCGTCGTAGGAGGCGCCCTGCTCTACCCTTATGGC
TTCGTCCGGTCAACCTCCATCATGGCAGCCGCCTTCTTCGAGCAGTTCTGCGTTCAGGGAGCATGGGGTGTGATC
CCCATACACCTCATGGAGTTATCTCCGGGAGCACTGCGCACCTTCGTCGTCGGTACGTCCTATCAGCTCGGCAAT
CTCGTCTCTTCGGCCTCGTCTACCATCGAGGCCCGTCTCGGCGAACGGTTTCCCCTTCCGTCTACCACCGAGGGT
GTGAAGAGGTACGATTACGGAAAGGTCATGTCCATCTTCATGGCTTGCGTCTATCTCTACGTCTTACTCCTGACC
TTTGTCGGACCGGAGAATTTGCGCCGCAGCTTCGATATCGAGCACGATGACGATGCTGACGCTGTCGTCGGCCGG
GATGCTGTTGAGCGGGCGGCGGCGGCGGGGAGGAGTCATGGAAGTGAAAAGGCGAGGCTGGATGAGGACGAGAAG
AAGAAGGAGGAGTCGATTGAAGCCTGA
Gene >Ophio5|7369
ATGGGTGGCCTCTACGGCAACGCTGCCGCCACCGCGCTGGAAGATTGTCCTCATGAGGCTCGTGGCTTGATGAGC
GGCATCCTCCAGCAAGGGGTAAGATGCTCAAACTCCCTTCTTTTTTTTTTTATTTCCCCTCACCTGACTCTCTCT
GTTTTTAATTTTTAATTTAAATTTTTTTTTTTTCACACCCCAGTACGCCTTCGGATATCTTCTCTGCGCCGCCTT
CGCCCGTGGCCTCGTCAACACAACCCCTTACGGCTGGCGACCACTCTTCTGGTTCGCCGCCTGTCCGCCCGTCCT
CTTCATCCTCTGGCGTCTCGTCCTCCCCGAAACGGCCAGCTACCGTGAACGGCAACGGTTACGGGTCGAGGCTGG
TCCGAGCCAGCACCGATCCGCCACTTCGACTTTCTTGGTCGAGGCCAAAGTCGCGCTGAGCCGGCATTGGCTTCT
CTTGACGTACATGGTGCTTCTCATGGCCGGCTTCAACTTTATGAGCCATGGCAGTCAGGATCTGTACCCGACCAT
GTTGGACAATCAGCTCGGCTTTTCTCCTACCGACGTCACCGTCACCCAGATCGTGGCCAATCTGGGTGCCATGCT
TGGAGGCACCGTCGTCGGCTTCTGCAGCCAGTCTGTCGGTCGACGCTTCAGCATCGTCGTCTGCTGCGTCGTAGG
AGGCGCCCTGCTCTACCCTTATGGCTTCGTCCGGTCAACCTCCATCATGGCAGCCGCCTTCTTCGAGCAGTTCTG
CGTTCAGGGAGCATGGGGTGTGATCCCCATACACCTCATGGAGTTATCTCCGGGAGCACTGCGCACCTTCGTCGT
CGGTACGTCCTATCAGCTCGGCAATCTCGTCTCTTCGGCCTCGTCTACCATCGAGGCCCGTCTCGGCGAACGGTT
TCCCCTTCCGTCTACCACCGAGGGTGTGAAGAGGTACGATTACGGAAAGGTCATGTCCATCTTCATGGCTTGCGT
CTATCTCTACGTCTTACTCCTGACCTTTGTCGGACCGGAGAATTTGCGCCGCAGCTTCGATATCGAGCACGATGA
CGATGCTGACGCTGTCGTCGGCCGGGATGCTGTTGAGCGGGCGGCGGCGGCGGGGAGGAGTCATGGAAGTGAAAA
GGCGAGGCTGGATGAGGACGAGAAGAAGAAGGAGGAGTCGATTGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail