Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7365
Gene name
Locationscaffold_704:2528..4050
Strand+
Gene length (bp)1522
Transcript length (bp)1365
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05971 Methyltransf_10 RNA methyltransferase 1.6E-59 29 298
PF05175 MTS Methyltransferase small domain 2.9E-07 118 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42662|MTT16_SCHPO Putative methyltransferase-like protein C27D7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27D7.08c PE=3 SV=2 49 443 2.0E-68
sp|Q6DC64|MET16_DANRE Methyltransferase-like protein 16 OS=Danio rerio GN=mettl16 PE=2 SV=1 31 350 9.0E-57
sp|Q6GR37|MET16_XENLA Methyltransferase-like protein 16 OS=Xenopus laevis GN=mettl16 PE=2 SV=1 31 344 5.0E-55
sp|Q9CQG2|MET16_MOUSE Methyltransferase-like protein 16 OS=Mus musculus GN=Mettl16 PE=1 SV=1 31 298 3.0E-54
sp|Q86W50|MET16_HUMAN Methyltransferase-like protein 16 OS=Homo sapiens GN=METTL16 PE=1 SV=2 31 298 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42662|MTT16_SCHPO Putative methyltransferase-like protein C27D7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27D7.08c PE=3 SV=2 49 443 2.0E-68
sp|Q6DC64|MET16_DANRE Methyltransferase-like protein 16 OS=Danio rerio GN=mettl16 PE=2 SV=1 31 350 9.0E-57
sp|Q6GR37|MET16_XENLA Methyltransferase-like protein 16 OS=Xenopus laevis GN=mettl16 PE=2 SV=1 31 344 5.0E-55
sp|Q9CQG2|MET16_MOUSE Methyltransferase-like protein 16 OS=Mus musculus GN=Mettl16 PE=1 SV=1 31 298 3.0E-54
sp|Q86W50|MET16_HUMAN Methyltransferase-like protein 16 OS=Homo sapiens GN=METTL16 PE=1 SV=2 31 298 4.0E-54
sp|Q5ZIA0|MET16_CHICK Methyltransferase-like protein 16 OS=Gallus gallus GN=METTL16 PE=2 SV=1 31 298 5.0E-54
sp|Q09357|MET16_CAEEL Methyltransferase-like protein 16 homolog OS=Caenorhabditis elegans GN=mett-10 PE=1 SV=2 31 405 4.0E-41
sp|Q61J97|MET16_CAEBR Methyltransferase-like protein 16 homolog OS=Caenorhabditis briggsae GN=CBG09879 PE=3 SV=1 31 299 2.0E-40
sp|Q3IBW7|RLMF_PSEHT Ribosomal RNA large subunit methyltransferase F OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rlmF PE=3 SV=2 29 298 3.0E-40
sp|Q290Z2|MET16_DROPS Methyltransferase-like protein 16 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA20428 PE=3 SV=2 32 300 8.0E-39
sp|Q4KHU0|RLMF_PSEF5 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rlmF PE=3 SV=2 34 306 2.0E-37
sp|Q554C9|MET16_DICDI Methyltransferase-like protein 16 homolog OS=Dictyostelium discoideum GN=DDB_G0275203 PE=3 SV=1 31 298 9.0E-37
sp|Q4ZXI1|RLMF_PSEU2 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rlmF PE=3 SV=1 34 298 3.0E-36
sp|Q1I5F5|RLMF_PSEE4 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas entomophila (strain L48) GN=rlmF PE=3 SV=1 34 298 5.0E-36
sp|Q7K3B9|MET16_DROME Methyltransferase-like protein 16 homolog OS=Drosophila melanogaster GN=CG7544 PE=2 SV=1 33 298 6.0E-36
sp|B1JBB3|RLMF_PSEPW Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas putida (strain W619) GN=rlmF PE=3 SV=1 34 306 1.0E-35
sp|Q48MF3|RLMF_PSE14 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rlmF PE=3 SV=2 34 298 2.0E-35
sp|Q88P77|RLMF_PSEPK Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas putida (strain KT2440) GN=rlmF PE=3 SV=1 34 298 7.0E-35
sp|A5VZ65|RLMF_PSEP1 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rlmF PE=3 SV=1 34 298 1.0E-34
sp|A4VP05|RLMF_PSEU5 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas stutzeri (strain A1501) GN=rlmF PE=3 SV=1 11 298 2.0E-34
sp|Q6ANQ6|RLMF_DESPS Ribosomal RNA large subunit methyltransferase F OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rlmF PE=3 SV=1 34 298 4.0E-34
sp|A6H0G2|RLMF_FLAPJ Ribosomal RNA large subunit methyltransferase F OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rlmF PE=3 SV=1 34 298 4.0E-34
sp|Q3KHM8|RLMF_PSEPF Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas fluorescens (strain Pf0-1) GN=rlmF PE=3 SV=1 5 298 4.0E-34
sp|A9R6I2|RLMF_YERPG Ribosomal RNA large subunit methyltransferase F OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rlmF PE=3 SV=1 7 308 1.0E-33
sp|B1JH95|RLMF_YERPY Ribosomal RNA large subunit methyltransferase F OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rlmF PE=3 SV=2 7 308 1.0E-33
sp|Q669D4|RLMF_YERPS Ribosomal RNA large subunit methyltransferase F OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rlmF PE=3 SV=1 7 308 1.0E-33
sp|B2K7Y6|RLMF_YERPB Ribosomal RNA large subunit methyltransferase F OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rlmF PE=3 SV=2 7 308 1.0E-33
sp|A7FGU1|RLMF_YERP3 Ribosomal RNA large subunit methyltransferase F OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rlmF PE=3 SV=1 7 308 1.0E-33
sp|A5FHX5|RLMF_FLAJ1 Ribosomal RNA large subunit methyltransferase F OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rlmF PE=3 SV=1 34 298 2.0E-33
sp|B5EVS5|RLMF_VIBFM Ribosomal RNA large subunit methyltransferase F OS=Vibrio fischeri (strain MJ11) GN=rlmF PE=3 SV=1 54 298 2.0E-33
sp|B0KQK4|RLMF_PSEPG Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas putida (strain GB-1) GN=rlmF PE=3 SV=1 34 298 2.0E-33
sp|Q1CHT7|RLMF_YERPN Ribosomal RNA large subunit methyltransferase F OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rlmF PE=3 SV=1 7 308 3.0E-33
sp|Q7CJ72|RLMF_YERPE Ribosomal RNA large subunit methyltransferase F OS=Yersinia pestis GN=rlmF PE=3 SV=1 7 308 3.0E-33
sp|Q1C6E5|RLMF_YERPA Ribosomal RNA large subunit methyltransferase F OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rlmF PE=3 SV=1 7 308 3.0E-33
sp|A4TM00|RLMF_YERPP Ribosomal RNA large subunit methyltransferase F OS=Yersinia pestis (strain Pestoides F) GN=rlmF PE=3 SV=1 7 298 4.0E-33
sp|A1SSI8|RLMF_PSYIN Ribosomal RNA large subunit methyltransferase F OS=Psychromonas ingrahamii (strain 37) GN=rlmF PE=3 SV=1 34 300 6.0E-33
sp|A8GBT4|RLMF_SERP5 Ribosomal RNA large subunit methyltransferase F OS=Serratia proteamaculans (strain 568) GN=rlmF PE=3 SV=1 7 298 9.0E-33
sp|C1DPF6|RLMF_AZOVD Ribosomal RNA large subunit methyltransferase F OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rlmF PE=3 SV=1 16 298 1.0E-32
sp|Q89YP0|RLMF_BACTN Ribosomal RNA large subunit methyltransferase F OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rlmF PE=3 SV=1 54 298 2.0E-32
sp|A0KHV5|RLMF_AERHH Ribosomal RNA large subunit methyltransferase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rlmF PE=3 SV=1 32 298 2.0E-32
sp|Q6D958|RLMF_PECAS Ribosomal RNA large subunit methyltransferase F OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmF PE=3 SV=1 54 298 3.0E-32
sp|A1JU40|RLMF_YERE8 Ribosomal RNA large subunit methyltransferase F OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rlmF PE=3 SV=1 7 308 3.0E-32
sp|Q887M4|RLMF_PSESM Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rlmF PE=3 SV=2 34 298 4.0E-32
sp|Q5DYC3|RLMF_VIBF1 Ribosomal RNA large subunit methyltransferase F OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rlmF PE=3 SV=1 54 298 5.0E-32
sp|C3K6G1|RLMF_PSEFS Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas fluorescens (strain SBW25) GN=rlmF PE=3 SV=1 34 298 7.0E-32
sp|Q9HXG4|RLMF_PSEAE Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rlmF PE=3 SV=1 12 298 1.0E-31
sp|Q02RZ9|RLMF_PSEAB Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rlmF PE=3 SV=1 12 298 1.0E-31
sp|B7UVS7|RLMF_PSEA8 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas aeruginosa (strain LESB58) GN=rlmF PE=3 SV=1 12 298 1.0E-31
sp|Q6LIW6|RLMF_PHOPR Ribosomal RNA large subunit methyltransferase F OS=Photobacterium profundum GN=rlmF PE=3 SV=1 34 298 2.0E-31
sp|A0M4S0|RLMF_GRAFK Ribosomal RNA large subunit methyltransferase F OS=Gramella forsetii (strain KT0803) GN=rlmF PE=3 SV=1 27 298 2.0E-31
sp|Q64RQ5|RLMF_BACFR Ribosomal RNA large subunit methyltransferase F OS=Bacteroides fragilis (strain YCH46) GN=rlmF PE=3 SV=1 34 298 5.0E-31
sp|C3LMU1|RLMF_VIBCM Ribosomal RNA large subunit methyltransferase F OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rlmF PE=3 SV=1 34 298 6.0E-31
sp|Q87Q26|RLMF_VIBPA Ribosomal RNA large subunit methyltransferase F OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rlmF PE=3 SV=1 34 298 1.0E-30
sp|Q5LBA7|RLMF_BACFN Ribosomal RNA large subunit methyltransferase F OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rlmF PE=3 SV=1 34 298 1.0E-30
sp|A6W2M9|RLMF_MARMS Ribosomal RNA large subunit methyltransferase F OS=Marinomonas sp. (strain MWYL1) GN=rlmF PE=3 SV=1 19 298 3.0E-30
sp|A7N060|RLMF_VIBCB Ribosomal RNA large subunit methyltransferase F OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rlmF PE=3 SV=1 34 298 3.0E-30
sp|Q9KRM2|RLMF_VIBCH Ribosomal RNA large subunit methyltransferase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmF PE=3 SV=1 34 298 3.0E-30
sp|C6D8Y7|RLMF_PECCP Ribosomal RNA large subunit methyltransferase F OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rlmF PE=3 SV=1 34 298 4.0E-30
sp|Q8EKF9|RLMF_SHEON Ribosomal RNA large subunit methyltransferase F OS=Shewanella oneidensis (strain MR-1) GN=rlmF PE=3 SV=2 27 298 1.0E-29
sp|Q1QEW1|RLMF_PSYCK Ribosomal RNA large subunit methyltransferase F OS=Psychrobacter cryohalolentis (strain K5) GN=rlmF PE=3 SV=2 16 299 1.0E-29
sp|Q11XA9|RLMF_CYTH3 Ribosomal RNA large subunit methyltransferase F OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rlmF PE=3 SV=1 18 298 1.0E-29
sp|Q4FVS6|RLMF_PSYA2 Ribosomal RNA large subunit methyltransferase F OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rlmF PE=3 SV=1 16 299 2.0E-28
sp|Q1H501|RLMF_METFK Ribosomal RNA large subunit methyltransferase F OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rlmF PE=3 SV=1 3 298 2.0E-28
sp|A9MIS5|RLMF_SALAR Ribosomal RNA large subunit methyltransferase F OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rlmF PE=3 SV=1 34 298 3.0E-28
sp|A8AIX5|RLMF_CITK8 Ribosomal RNA large subunit methyltransferase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rlmF PE=3 SV=1 24 298 3.0E-28
sp|A3DAC9|RLMF_SHEB5 Ribosomal RNA large subunit methyltransferase F OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rlmF PE=3 SV=2 25 298 3.0E-28
sp|A6WHK9|RLMF_SHEB8 Ribosomal RNA large subunit methyltransferase F OS=Shewanella baltica (strain OS185) GN=rlmF PE=3 SV=1 25 298 4.0E-28
sp|A6V0S3|RLMF_PSEA7 Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas aeruginosa (strain PA7) GN=rlmF PE=3 SV=2 54 298 4.0E-28
sp|A5WBC6|RLMF_PSYWF Ribosomal RNA large subunit methyltransferase F OS=Psychrobacter sp. (strain PRwf-1) GN=rlmF PE=3 SV=1 25 298 6.0E-28
sp|A9KVB0|RLMF_SHEB9 Ribosomal RNA large subunit methyltransferase F OS=Shewanella baltica (strain OS195) GN=rlmF PE=3 SV=1 25 298 6.0E-28
sp|A4SKI2|RLMF_AERS4 Ribosomal RNA large subunit methyltransferase F OS=Aeromonas salmonicida (strain A449) GN=rlmF PE=3 SV=1 32 298 7.0E-28
sp|A1RQ03|RLMF_SHESW Ribosomal RNA large subunit methyltransferase F OS=Shewanella sp. (strain W3-18-1) GN=rlmF PE=3 SV=1 27 298 8.0E-28
sp|A4Y1N1|RLMF_SHEPC Ribosomal RNA large subunit methyltransferase F OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rlmF PE=3 SV=1 27 298 8.0E-28
sp|B1KP42|RLMF_SHEWM Ribosomal RNA large subunit methyltransferase F OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rlmF PE=3 SV=1 27 305 2.0E-27
sp|Q47C26|RLMF_DECAR Ribosomal RNA large subunit methyltransferase F OS=Dechloromonas aromatica (strain RCB) GN=rlmF PE=3 SV=1 54 298 2.0E-27
sp|A5F7R5|RLMF_VIBC3 Putative ribosomal RNA large subunit methyltransferase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rlmF PE=5 SV=2 34 298 2.0E-27
sp|A4W8E5|RLMF_ENT38 Ribosomal RNA large subunit methyltransferase F OS=Enterobacter sp. (strain 638) GN=rlmF PE=3 SV=1 54 298 3.0E-27
sp|B5XYT7|RLMF_KLEP3 Ribosomal RNA large subunit methyltransferase F OS=Klebsiella pneumoniae (strain 342) GN=rlmF PE=3 SV=1 24 298 3.0E-27
sp|A9MSU1|RLMF_SALPB Ribosomal RNA large subunit methyltransferase F OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rlmF PE=3 SV=1 34 298 5.0E-27
sp|B4TC80|RLMF_SALHS Ribosomal RNA large subunit methyltransferase F OS=Salmonella heidelberg (strain SL476) GN=rlmF PE=3 SV=1 34 298 5.0E-27
sp|B5BC01|RLMF_SALPK Ribosomal RNA large subunit methyltransferase F OS=Salmonella paratyphi A (strain AKU_12601) GN=rlmF PE=3 SV=1 34 298 5.0E-27
sp|Q5PG24|RLMF_SALPA Ribosomal RNA large subunit methyltransferase F OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rlmF PE=3 SV=1 34 298 5.0E-27
sp|A6T6Q1|RLMF_KLEP7 Ribosomal RNA large subunit methyltransferase F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rlmF PE=3 SV=1 24 298 6.0E-27
sp|A7MEZ1|RLMF_CROS8 Ribosomal RNA large subunit methyltransferase F OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rlmF PE=3 SV=1 24 298 7.0E-27
sp|Q12T32|RLMF_SHEDO Ribosomal RNA large subunit methyltransferase F OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rlmF PE=3 SV=1 34 309 7.0E-27
sp|A4XY67|RLMF_PSEMY Ribosomal RNA large subunit methyltransferase F OS=Pseudomonas mendocina (strain ymp) GN=rlmF PE=3 SV=1 34 298 7.0E-27
sp|B4TQW9|RLMF_SALSV Ribosomal RNA large subunit methyltransferase F OS=Salmonella schwarzengrund (strain CVM19633) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|Q8ZQN4|RLMF_SALTY Ribosomal RNA large subunit methyltransferase F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B4T083|RLMF_SALNS Ribosomal RNA large subunit methyltransferase F OS=Salmonella newport (strain SL254) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B5R792|RLMF_SALG2 Ribosomal RNA large subunit methyltransferase F OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B5QXT1|RLMF_SALEP Ribosomal RNA large subunit methyltransferase F OS=Salmonella enteritidis PT4 (strain P125109) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B5FP91|RLMF_SALDC Ribosomal RNA large subunit methyltransferase F OS=Salmonella dublin (strain CT_02021853) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B5F0A4|RLMF_SALA4 Ribosomal RNA large subunit methyltransferase F OS=Salmonella agona (strain SL483) GN=rlmF PE=3 SV=1 34 298 9.0E-27
sp|B7NNN9|RLMF_ECO7I Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rlmF PE=3 SV=1 23 298 1.0E-26
sp|B8E3W0|RLMF_SHEB2 Ribosomal RNA large subunit methyltransferase F OS=Shewanella baltica (strain OS223) GN=rlmF PE=3 SV=1 25 298 2.0E-26
sp|Q15VI3|RLMF_PSEA6 Ribosomal RNA large subunit methyltransferase F OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rlmF PE=3 SV=1 52 298 2.0E-26
sp|A0KRF2|RLMF_SHESA Ribosomal RNA large subunit methyltransferase F OS=Shewanella sp. (strain ANA-3) GN=rlmF PE=3 SV=1 24 298 2.0E-26
sp|Q08A02|RLMF_SHEFN Ribosomal RNA large subunit methyltransferase F OS=Shewanella frigidimarina (strain NCIMB 400) GN=rlmF PE=3 SV=1 29 298 3.0E-26
sp|Q3Z3X8|RLMF_SHISS Ribosomal RNA large subunit methyltransferase F OS=Shigella sonnei (strain Ss046) GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|Q323Y7|RLMF_SHIBS Ribosomal RNA large subunit methyltransferase F OS=Shigella boydii serotype 4 (strain Sb227) GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|B2TVC2|RLMF_SHIB3 Ribosomal RNA large subunit methyltransferase F OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|Q1REB8|RLMF_ECOUT Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain UTI89 / UPEC) GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|Q0TJP1|RLMF_ECOL5 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|A1A947|RLMF_ECOK1 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O1:K1 / APEC GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|B7M782|RLMF_ECO8A Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O8 (strain IAI1) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|B7MQR1|RLMF_ECO81 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O81 (strain ED1a) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|B7LC90|RLMF_ECO55 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain 55989 / EAEC) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|B7MGR5|RLMF_ECO45 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|A7ZJM2|RLMF_ECO24 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rlmF PE=3 SV=2 23 298 5.0E-26
sp|B7NAA7|RLMF_ECOLU Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rlmF PE=3 SV=1 23 298 5.0E-26
sp|Q482M9|RLMF_COLP3 Ribosomal RNA large subunit methyltransferase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rlmF PE=3 SV=1 34 298 8.0E-26
sp|B7LJV2|RLMF_ESCF3 Ribosomal RNA large subunit methyltransferase F OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rlmF PE=3 SV=1 23 298 9.0E-26
sp|Q8FJM4|RLMF_ECOL6 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmF PE=3 SV=2 23 298 1.0E-25
sp|A3QJF9|RLMF_SHELP Ribosomal RNA large subunit methyltransferase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rlmF PE=3 SV=1 25 298 1.0E-25
sp|Q21P11|RLMF_SACD2 Ribosomal RNA large subunit methyltransferase F OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rlmF PE=3 SV=1 25 300 1.0E-25
sp|P75782|RLMF_ECOLI Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain K12) GN=rlmF PE=1 SV=2 23 298 2.0E-25
sp|B1IXG1|RLMF_ECOLC Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rlmF PE=3 SV=1 23 298 2.0E-25
sp|A7ZY64|RLMF_ECOHS Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O9:H4 (strain HS) GN=rlmF PE=3 SV=2 23 298 2.0E-25
sp|B1X7D7|RLMF_ECODH Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain K12 / DH10B) GN=rlmF PE=3 SV=1 23 298 2.0E-25
sp|C4ZXX9|RLMF_ECOBW Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rlmF PE=3 SV=1 23 298 2.0E-25
sp|Q0HP08|RLMF_SHESM Ribosomal RNA large subunit methyltransferase F OS=Shewanella sp. (strain MR-4) GN=rlmF PE=3 SV=1 14 298 2.0E-25
sp|Q83LU4|RLMF_SHIFL Ribosomal RNA large subunit methyltransferase F OS=Shigella flexneri GN=rlmF PE=3 SV=2 23 298 3.0E-25
sp|Q0T6F4|RLMF_SHIF8 Ribosomal RNA large subunit methyltransferase F OS=Shigella flexneri serotype 5b (strain 8401) GN=rlmF PE=3 SV=2 23 298 3.0E-25
sp|B0TM80|RLMF_SHEHH Ribosomal RNA large subunit methyltransferase F OS=Shewanella halifaxensis (strain HAW-EB4) GN=rlmF PE=3 SV=1 54 305 3.0E-25
sp|Q0I0H7|RLMF_SHESR Ribosomal RNA large subunit methyltransferase F OS=Shewanella sp. (strain MR-7) GN=rlmF PE=3 SV=1 14 298 3.0E-25
sp|B1LM99|RLMF_ECOSM Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rlmF PE=3 SV=1 23 298 4.0E-25
sp|B5YS99|RLMF_ECO5E Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rlmF PE=3 SV=1 23 298 1.0E-24
sp|Q8X7W6|RLMF_ECO57 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O157:H7 GN=rlmF PE=3 SV=2 23 298 1.0E-24
sp|Q32I85|RLMF_SHIDS Ribosomal RNA large subunit methyltransferase F OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rlmF PE=3 SV=2 23 298 2.0E-24
sp|B7UM03|RLMF_ECO27 Ribosomal RNA large subunit methyltransferase F OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rlmF PE=3 SV=1 23 298 2.0E-24
sp|Q7MLD9|RLMF_VIBVY Ribosomal RNA large subunit methyltransferase F OS=Vibrio vulnificus (strain YJ016) GN=rlmF PE=3 SV=1 34 298 3.0E-24
sp|A8HA69|RLMF_SHEPA Ribosomal RNA large subunit methyltransferase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rlmF PE=3 SV=1 34 305 5.0E-24
sp|Q8D935|RLMF_VIBVU Ribosomal RNA large subunit methyltransferase F OS=Vibrio vulnificus (strain CMCP6) GN=rlmF PE=3 SV=1 34 298 7.0E-24
sp|A8G1Q8|RLMF_SHESH Ribosomal RNA large subunit methyltransferase F OS=Shewanella sediminis (strain HAW-EB3) GN=rlmF PE=3 SV=1 6 305 7.0E-20
sp|A1SBR7|RLMF_SHEAM Ribosomal RNA large subunit methyltransferase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rlmF PE=3 SV=1 14 298 2.0E-19
sp|Q60354|Y046_METJA Putative methyltransferase MJ0046 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0046 PE=3 SV=1 53 202 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7365
MCSVRKLDDDKTFPQPDPSAKDGRFHSLYLEPPDFKRLARCDPDFAALVSGRRLDFGDPASVMQLSKTLLKLDFG
LDLVLPQDRLCPPIPNRHNYVLWLKGLLDTSSYSPPGQELLGLDIGTGASCIYPLVACVQRPWSFVATDIDAESL
AWARRNVQLNKLGHRIRVVDRNADDDLIPLDHLGLDSIDFVMTNPPFYASEADMLESARRKARPPWSACTGSRTE
MVVEGGEVAFVGRIMSESLVLGRRVGWYSATLGFYASVANLVGRLKEHDIHNYAVTEFVQGAKTRRWAVAWSFGP
MRPSQAVARGIKATSDLLPAATEAEVASSALPTECVGEFVRRLKNAIEALDLMSWTWDAQALEGTGRAPGRVWAR
AWRRKKKLEAEKATDDGPMHEAEPACVLGFRVEIRVALRLVSVRCRWLEGVDAAAFESFQGFLQAAARTAFADGG
GERG
Coding >Ophio5|7365
ATGTGCTCAGTGCGCAAGCTCGACGACGACAAGACCTTCCCCCAGCCAGATCCGTCCGCCAAAGACGGCCGATTC
CACAGCCTCTACTTGGAGCCGCCCGACTTCAAGCGGCTGGCGCGATGTGACCCAGACTTTGCCGCCCTGGTTTCG
GGCCGCCGGCTAGACTTTGGCGACCCTGCTTCTGTTATGCAGCTGTCCAAGACGCTGCTGAAGCTCGACTTTGGT
CTTGACCTTGTCCTGCCTCAGGACCGGCTCTGTCCTCCGATCCCGAACAGACACAACTACGTCCTCTGGCTCAAG
GGATTGCTCGACACTTCCTCCTACAGCCCTCCGGGCCAGGAACTGCTCGGCCTCGATATCGGCACCGGCGCCAGC
TGCATTTATCCTCTCGTCGCTTGCGTCCAGCGGCCGTGGTCATTCGTCGCCACGGACATCGACGCCGAGAGCTTA
GCCTGGGCCAGGAGAAACGTTCAGCTGAACAAGCTGGGCCATCGGATCAGAGTCGTCGACCGCAACGCCGACGAT
GACCTCATACCACTGGACCATCTCGGCCTGGATTCCATCGACTTTGTCATGACGAACCCGCCCTTCTACGCCTCC
GAAGCCGACATGCTCGAAAGCGCTCGGCGCAAGGCCCGGCCCCCCTGGTCCGCCTGCACCGGGTCCCGGACGGAA
ATGGTTGTCGAGGGCGGAGAAGTGGCCTTCGTTGGCCGGATCATGAGCGAGTCGTTGGTCCTCGGCCGCCGGGTC
GGATGGTACAGCGCCACGCTAGGCTTCTACGCCAGCGTCGCGAACCTGGTCGGCCGCCTCAAGGAGCACGATATC
CATAACTACGCCGTCACCGAGTTCGTGCAGGGTGCCAAGACGAGACGCTGGGCTGTGGCCTGGAGTTTCGGGCCC
ATGCGGCCGTCACAGGCCGTTGCCAGGGGCATCAAGGCCACTTCCGACCTGTTACCCGCCGCGACCGAAGCCGAG
GTCGCCAGCTCGGCACTACCGACAGAATGCGTGGGTGAATTCGTCCGGCGGCTGAAGAACGCCATCGAGGCACTT
GACTTGATGTCCTGGACGTGGGACGCGCAGGCGCTCGAGGGCACGGGACGCGCACCTGGTAGGGTCTGGGCCCGG
GCGTGGCGAAGGAAGAAAAAGCTCGAGGCCGAGAAGGCGACGGACGACGGGCCGATGCACGAGGCCGAGCCGGCT
TGCGTCCTGGGCTTCCGGGTCGAGATACGGGTCGCGCTGAGGCTGGTCTCGGTGAGGTGTCGGTGGCTGGAGGGG
GTGGATGCGGCGGCCTTTGAGAGCTTTCAGGGCTTTCTGCAGGCGGCGGCGAGGACTGCGTTTGCCGACGGGGGA
GGAGAGCGAGGA
Transcript >Ophio5|7365
ATGTGCTCAGTGCGCAAGCTCGACGACGACAAGACCTTCCCCCAGCCAGATCCGTCCGCCAAAGACGGCCGATTC
CACAGCCTCTACTTGGAGCCGCCCGACTTCAAGCGGCTGGCGCGATGTGACCCAGACTTTGCCGCCCTGGTTTCG
GGCCGCCGGCTAGACTTTGGCGACCCTGCTTCTGTTATGCAGCTGTCCAAGACGCTGCTGAAGCTCGACTTTGGT
CTTGACCTTGTCCTGCCTCAGGACCGGCTCTGTCCTCCGATCCCGAACAGACACAACTACGTCCTCTGGCTCAAG
GGATTGCTCGACACTTCCTCCTACAGCCCTCCGGGCCAGGAACTGCTCGGCCTCGATATCGGCACCGGCGCCAGC
TGCATTTATCCTCTCGTCGCTTGCGTCCAGCGGCCGTGGTCATTCGTCGCCACGGACATCGACGCCGAGAGCTTA
GCCTGGGCCAGGAGAAACGTTCAGCTGAACAAGCTGGGCCATCGGATCAGAGTCGTCGACCGCAACGCCGACGAT
GACCTCATACCACTGGACCATCTCGGCCTGGATTCCATCGACTTTGTCATGACGAACCCGCCCTTCTACGCCTCC
GAAGCCGACATGCTCGAAAGCGCTCGGCGCAAGGCCCGGCCCCCCTGGTCCGCCTGCACCGGGTCCCGGACGGAA
ATGGTTGTCGAGGGCGGAGAAGTGGCCTTCGTTGGCCGGATCATGAGCGAGTCGTTGGTCCTCGGCCGCCGGGTC
GGATGGTACAGCGCCACGCTAGGCTTCTACGCCAGCGTCGCGAACCTGGTCGGCCGCCTCAAGGAGCACGATATC
CATAACTACGCCGTCACCGAGTTCGTGCAGGGTGCCAAGACGAGACGCTGGGCTGTGGCCTGGAGTTTCGGGCCC
ATGCGGCCGTCACAGGCCGTTGCCAGGGGCATCAAGGCCACTTCCGACCTGTTACCCGCCGCGACCGAAGCCGAG
GTCGCCAGCTCGGCACTACCGACAGAATGCGTGGGTGAATTCGTCCGGCGGCTGAAGAACGCCATCGAGGCACTT
GACTTGATGTCCTGGACGTGGGACGCGCAGGCGCTCGAGGGCACGGGACGCGCACCTGGTAGGGTCTGGGCCCGG
GCGTGGCGAAGGAAGAAAAAGCTCGAGGCCGAGAAGGCGACGGACGACGGGCCGATGCACGAGGCCGAGCCGGCT
TGCGTCCTGGGCTTCCGGGTCGAGATACGGGTCGCGCTGAGGCTGGTCTCGGTGAGGTGTCGGTGGCTGGAGGGG
GTGGATGCGGCGGCCTTTGAGAGCTTTCAGGGCTTTCTGCAGGCGGCGGCGAGGACTGCGTTTGCCGACGGGGGA
GGAGAGCGAGGATGA
Gene >Ophio5|7365
ATGTGCTCAGTGCGCAAGCTCGACGACGACAAGACCTTCCCCCAGCCAGATCCGTCCGCCAAAGACGGCCGATTC
CACAGCCTCTACTTGGAGCCGCCCGACTTCAAGCGGCTGGCGCGATGTGACCCAGACTTTGCCGCCCTGTATGTG
CTTCCCGGCCCGTGAGAGGGAGGCTGTCTGGCTCATTCTGCCTGGTAGGGTTTCGGGCCGCCGGCTAGACTTTGG
CGACCCTGCTTCTGTTATGCAGCTGTCCAAGACGCTGCTGAAGCTCGACTTTGGTCTTGACCTTGTCCTGCCTCA
GGACCGGCTCTGTCCTCCGGTGCGTGAGCCCTTTCCCGGACCTGCGAATTTCCAGAGTTTGACGGTGGCAGCAGA
TCCCGAACAGACACAACTACGTCCTCTGGCTCAAGGGATTGCTCGACACTTCCTCCTACAGCCCTCCGGGCCAGG
AACTGCTCGGCCTCGATATCGGCACCGGCGCCAGCTGCATTTATCCTCTCGTCGCTTGCGTCCAGCGGCCGTGGT
CATTCGTCGCCACGGGTAAGGAGAATTTGGCTGTTTCCTTGCGTCCATGACTGACGAAACAGACATCGACGCCGA
GAGCTTAGCCTGGGCCAGGAGAAACGTTCAGCTGAACAAGCTGGGCCATCGGATCAGAGTCGTCGACCGCAACGC
CGACGATGACCTCATACCACTGGACCATCTCGGCCTGGATTCCATCGACTTTGTCATGACGAACCCGCCCTTCTA
CGCCTCCGAAGCCGACATGCTCGAAAGCGCTCGGCGCAAGGCCCGGCCCCCCTGGTCCGCCTGCACCGGGTCCCG
GACGGAAATGGTTGTCGAGGGCGGAGAAGTGGCCTTCGTTGGCCGGATCATGAGCGAGTCGTTGGTCCTCGGCCG
CCGGGTCGGATGGTACAGCGCCACGCTAGGCTTCTACGCCAGCGTCGCGAACCTGGTCGGCCGCCTCAAGGAGCA
CGATATCCATAACTACGCCGTCACCGAGTTCGTGCAGGGTGCCAAGACGAGACGCTGGGCTGTGGCCTGGAGTTT
CGGGCCCATGCGGCCGTCACAGGCCGTTGCCAGGGGCATCAAGGCCACTTCCGACCTGTTACCCGCCGCGACCGA
AGCCGAGGTCGCCAGCTCGGCACTACCGACAGAATGCGTGGGTGAATTCGTCCGGCGGCTGAAGAACGCCATCGA
GGCACTTGACTTGATGTCCTGGACGTGGGACGCGCAGGCGCTCGAGGGCACGGGACGCGCACCTGGTAGGGTCTG
GGCCCGGGCGTGGCGAAGGAAGAAAAAGCTCGAGGCCGAGAAGGCGACGGACGACGGGCCGATGCACGAGGCCGA
GCCGGCTTGCGTCCTGGGCTTCCGGGTCGAGATACGGGTCGCGCTGAGGCTGGTCTCGGTGAGGTGTCGGTGGCT
GGAGGGGGTGGATGCGGCGGCCTTTGAGAGCTTTCAGGGCTTTCTGCAGGCGGCGGCGAGGACTGCGTTTGCCGA
CGGGGGAGGAGAGCGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail