Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7351
Gene name
Locationscaffold_70:41767..45062
Strand+
Gene length (bp)3295
Transcript length (bp)3078
Coding sequence length (bp)3075
Protein length (aa) 1025

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.7E-49 506 694
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.8E-26 713 921
PF00403 HMA Heavy-metal-associated domain 4.6E-08 227 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 66 1020 0.0E+00
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 227 1015 3.0E-95
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 227 1015 3.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 66 1020 0.0E+00
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 227 1015 3.0E-95
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 227 1015 3.0E-95
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 227 1015 6.0E-95
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 227 1015 1.0E-94
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 228 998 2.0E-94
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 227 1015 2.0E-94
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 227 1015 4.0E-94
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 227 1015 4.0E-94
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 227 1015 7.0E-94
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 227 1015 7.0E-94
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 227 1015 7.0E-94
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 228 998 3.0E-93
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 227 988 6.0E-93
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 226 1015 9.0E-91
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 226 1015 9.0E-91
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 310 987 3.0E-86
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 228 992 5.0E-86
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 370 1021 1.0E-85
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 228 992 2.0E-85
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 228 992 3.0E-85
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 228 990 1.0E-82
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 225 987 3.0E-81
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 228 990 4.0E-81
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 228 990 7.0E-81
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 226 1015 1.0E-80
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 224 1015 2.0E-80
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 216 990 2.0E-78
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 228 990 3.0E-78
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 218 991 2.0E-77
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 398 1012 2.0E-76
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 217 990 2.0E-76
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 438 987 3.0E-76
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 438 987 3.0E-76
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 192 999 6.0E-76
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 432 1015 5.0E-73
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 402 1009 1.0E-72
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 227 997 2.0E-71
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 439 1014 7.0E-68
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 439 1014 8.0E-68
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 387 1016 9.0E-68
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 439 1014 4.0E-67
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 439 1014 5.0E-67
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 439 1014 5.0E-67
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 439 1014 7.0E-67
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 432 1009 9.0E-67
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 422 1010 1.0E-66
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 432 1009 4.0E-66
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 415 1016 6.0E-66
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 422 1010 7.0E-66
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 415 1016 1.0E-65
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 439 1014 1.0E-65
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 439 1014 2.0E-65
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 409 1016 7.0E-65
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 409 1015 1.0E-64
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 422 1010 2.0E-64
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 422 1010 3.0E-64
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 423 1023 9.0E-63
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 422 1010 2.0E-62
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 432 1018 2.0E-62
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 429 998 2.0E-62
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 224 1016 3.0E-62
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 224 1016 5.0E-62
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 373 989 2.0E-61
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 373 989 2.0E-61
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 224 1015 1.0E-57
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 402 976 2.0E-56
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 399 1023 1.0E-54
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 478 982 4.0E-54
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 476 982 1.0E-53
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 476 982 5.0E-53
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 476 982 2.0E-52
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 317 989 9.0E-49
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 502 982 6.0E-48
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 399 983 1.0E-47
sp|Q59207|FIXI_BRADU Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 402 988 3.0E-47
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 399 989 9.0E-47
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 399 989 1.0E-46
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 399 989 1.0E-46
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 477 972 3.0E-46
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 463 946 6.0E-45
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 502 1016 1.0E-44
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 392 982 5.0E-44
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 426 985 1.0E-43
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 473 1016 2.0E-42
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 517 975 5.0E-42
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 517 975 5.0E-42
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 432 974 2.0E-41
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 527 985 5.0E-41
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 527 985 5.0E-41
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 527 985 5.0E-41
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 443 1013 5.0E-40
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 474 974 9.0E-40
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 520 987 8.0E-39
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 469 969 4.0E-38
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 472 913 1.0E-37
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 472 913 1.0E-37
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 472 913 1.0E-37
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 402 981 8.0E-36
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 404 981 4.0E-35
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 395 946 1.0E-33
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 395 946 1.0E-33
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 395 946 1.0E-33
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 478 928 1.0E-28
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 478 928 8.0E-28
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 478 928 8.0E-28
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 478 928 8.0E-28
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 478 928 8.0E-28
sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 474 821 8.0E-28
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 479 946 2.0E-26
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 502 946 5.0E-24
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 494 946 2.0E-23
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 516 946 4.0E-23
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 455 946 4.0E-23
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 491 928 3.0E-22
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 491 928 3.0E-22
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 441 928 4.0E-22
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 471 946 4.0E-22
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 491 928 1.0E-21
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 491 928 1.0E-21
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 491 928 1.0E-21
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 491 928 1.0E-21
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 491 928 1.0E-21
sp|Q9M3H5|HMA1_ARATH Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana GN=HMA1 PE=2 SV=2 454 953 1.0E-21
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 476 928 1.0E-21
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 491 928 2.0E-21
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 483 946 3.0E-21
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 476 928 3.0E-21
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 476 928 3.0E-21
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 476 928 4.0E-21
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 476 928 5.0E-21
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 476 928 6.0E-21
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 491 928 8.0E-21
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 476 928 1.0E-20
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 476 928 1.0E-20
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 476 928 1.0E-20
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 476 928 2.0E-20
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 516 946 2.0E-20
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 476 928 2.0E-20
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 502 946 1.0E-19
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 527 946 2.0E-19
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 516 946 2.0E-19
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 473 926 3.0E-19
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 470 946 3.0E-19
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 527 946 2.0E-18
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 496 946 2.0E-18
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 422 946 2.0E-18
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 514 928 3.0E-18
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 527 946 3.0E-18
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 515 946 3.0E-18
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 527 946 3.0E-18
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 527 946 3.0E-18
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 527 946 3.0E-18
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 470 946 3.0E-18
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 439 926 3.0E-18
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 496 946 3.0E-18
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 496 946 3.0E-18
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 527 946 4.0E-18
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 503 982 4.0E-18
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 527 946 4.0E-18
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 527 946 4.0E-18
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 527 946 4.0E-18
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 527 946 5.0E-18
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 483 946 5.0E-18
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 483 946 5.0E-18
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 483 946 5.0E-18
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 527 946 5.0E-18
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 527 946 5.0E-18
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 527 946 6.0E-18
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 527 946 6.0E-18
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 527 946 6.0E-18
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 527 946 6.0E-18
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 514 946 6.0E-18
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 454 947 6.0E-18
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 527 946 7.0E-18
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 527 946 7.0E-18
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 527 946 7.0E-18
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 527 946 7.0E-18
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 527 946 7.0E-18
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 455 928 7.0E-18
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 516 946 9.0E-18
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 527 946 9.0E-18
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 527 946 9.0E-18
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 527 946 1.0E-17
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 432 946 1.0E-17
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 483 926 1.0E-17
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 527 946 2.0E-17
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 527 946 3.0E-17
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 527 946 3.0E-17
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 527 946 3.0E-17
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 527 946 3.0E-17
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 514 946 4.0E-17
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 527 946 5.0E-17
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 514 1016 5.0E-17
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 527 946 5.0E-17
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 527 946 5.0E-17
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 521 926 5.0E-17
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 482 977 5.0E-17
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 476 926 7.0E-17
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 476 926 7.0E-17
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 514 968 2.0E-16
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 437 926 3.0E-16
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 475 946 3.0E-16
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 486 946 4.0E-16
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 486 946 5.0E-16
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 486 946 5.0E-16
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 486 946 5.0E-16
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 527 946 2.0E-15
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 527 946 2.0E-15
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 526 946 3.0E-15
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 473 934 5.0E-15
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 499 756 5.0E-15
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 516 946 6.0E-15
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 499 756 1.0E-14
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 475 946 1.0E-14
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 513 968 2.0E-14
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 516 946 2.0E-14
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 513 968 2.0E-14
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 482 982 3.0E-14
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 477 928 3.0E-14
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 478 944 5.0E-14
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 513 982 5.0E-14
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 526 946 5.0E-14
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 513 982 8.0E-14
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 513 968 8.0E-14
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 513 968 9.0E-14
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 475 946 9.0E-14
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 527 946 2.0E-13
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 513 968 2.0E-13
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 513 968 3.0E-13
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 482 982 3.0E-13
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 513 968 5.0E-13
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 513 968 7.0E-13
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 513 968 2.0E-12
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 503 982 3.0E-12
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 513 968 3.0E-12
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 482 982 5.0E-12
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 513 968 1.0E-11
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 503 982 6.0E-11
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 478 944 6.0E-11
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 513 968 7.0E-11
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 553 982 6.0E-10
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 553 982 6.0E-10
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 513 786 6.0E-10
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 553 982 7.0E-10
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 506 722 1.0E-09
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 849 946 4.0E-09
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 512 728 6.0E-09
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 713 946 7.0E-09
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 453 944 8.0E-09
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 816 1024 8.0E-09
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 482 982 3.0E-08
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 831 944 5.0E-08
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 513 743 3.0E-07
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 482 982 3.0E-07
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 520 727 1.0E-06
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 805 1024 1.0E-06
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 805 1024 1.0E-06
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 477 728 1.0E-06
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 805 1024 1.0E-06
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 810 1024 2.0E-06
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 513 728 2.0E-06
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 473 748 4.0E-06
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 870 1024 5.0E-06
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 824 951 5.0E-06
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 824 951 5.0E-06
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 805 1024 6.0E-06
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 805 1024 8.0E-06
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 479 723 9.0E-06
sp|Q58378|PATS_METJA Soluble P-type ATPase-like phosphatase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=patS PE=1 SV=3 818 946 9.0E-06
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 831 1023 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Transmembrane domain 0.1582 0.1207 0.019 0.4657 0.1985 0.0257 0.5315 0.4958 0.5744 0.0394

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 399 421 22
2 442 464 22
3 469 491 22
4 622 644 22
5 664 686 22
6 966 988 22
7 998 1020 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup373
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1321
Ophiocordyceps australis map64 (Brazil) OphauB2|4776
Ophiocordyceps camponoti-floridani Ophcf2|02982
Ophiocordyceps camponoti-rufipedis Ophun1|5321
Ophiocordyceps kimflemingae Ophio5|4426
Ophiocordyceps kimflemingae Ophio5|7351 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10343
Ophiocordyceps subramaniannii Hirsu2|11034
Ophiocordyceps subramaniannii Hirsu2|7397

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7351
MAFGNCCSHDHDDAVASRLEPAAQDDSLMEEEEEECRNGESCCEGVTPRRSSTVTGCDLEEEPCDSYPEKCILKI
ATIECEQRRGDGLDGTTGKGHEHDTDGNHPTSACRNHRVEAFERYSAYLESARCICDSVLEQGWSEGCCDERQPK
GRATTMSPGEHPNAYYASSRVLRGHHGVKRRHRHSVSRDGCCGSDDEHHREPVLDMCAAALKSGADLEKAQGLEP
ITLSVDGMTCSGCGIKMERVLKAQAGVSSVRVNFVMGSAELSLDTSITSPDGLVRAAERGSGFRCTRLSSDDQAI
DFLAAGPSAKALVNATIPGVRETTMVSSRVVRVTYDPAVIGARALMRQVGPFSSGLAPPVDDAGVSSGRRRLRDG
LIKTTASACCTLPIVIMAWSEKLVDAWTEALTAMVLATVVQLIAVPDFYLPATRALLHSGSLEMDMLVVISITAA
YTYSVVAFGFFMAGRPLEVGALFETSTLLVTLVLLGRLVAAFARLRAVAAVSLRSLQAATCVIVEDGKDREMDSR
LLQYGDELKIGAHAAVPTDATVIGGISEVDESIITGESLPVTKKPGDMVIAGTVNGSGMLRARLRRLPGKNTVTD
IARLVEEAASSRPKIQETADGVASWFVPVVTAIALIVIIVWIVVGLKVRGYGAGEAVANAMTYAVATLAVSCPCA
LGLAVPMVLVVAGGIAARNGVIIKSAGCTERSRKVTDVVLDKTGTITEAALDVTSEQFFASASRDEAMAVSKALV
ADSRHPVSLAVAKHLEERSVTPARLTDTRVIPGSGVKGVLRGSTVCAGNASWTETGHHPAVVRLLERGLTLLVVT
RDGEPLAVFGMRTKLRSEAAGVVSQLHRQKIVVHVVSGDHKGAVDAVAAQVGISHVVSQCSPADKRDYVAELMSR
GRYVMFVGDGTNDAIAVAQADVGVQLASVESSSEVTRGAADVVLLNGLEGIRFLLRISAVSFRRIVFNFVWSAAY
NVLAILLASGALVDVRIPPAYAGLGEIVSVLPVILAAVTMLWKGIRADGA
Coding >Ophio5|7351
ATGGCCTTCGGAAACTGCTGCTCGCACGACCATGATGACGCTGTTGCCTCTCGTCTCGAGCCTGCAGCCCAAGAT
GATAGCCTTATGGAGGAGGAGGAGGAGGAGTGCCGTAACGGAGAAAGCTGCTGCGAGGGGGTCACACCCAGGCGG
TCGTCGACCGTCACCGGCTGCGACTTGGAGGAGGAGCCCTGCGATAGCTACCCAGAGAAATGCATTCTCAAGATT
GCCACCATCGAGTGCGAGCAGAGGCGCGGAGACGGCTTGGATGGCACGACCGGTAAGGGGCACGAACACGACACA
GACGGCAACCATCCGACCTCAGCCTGCCGCAACCACCGAGTCGAGGCCTTTGAGCGATACAGCGCCTACCTCGAG
TCGGCCCGCTGCATCTGCGACAGCGTCTTGGAGCAGGGCTGGTCCGAGGGCTGCTGTGACGAGCGGCAGCCCAAG
GGGCGCGCGACAACGATGAGCCCCGGCGAACACCCGAATGCATACTATGCGAGCAGCCGAGTCCTCCGCGGCCAC
CATGGCGTGAAACGCCGCCATAGGCATAGTGTTAGCAGGGACGGCTGCTGCGGCTCAGACGACGAGCACCATCGC
GAGCCGGTCCTCGACATGTGTGCTGCGGCCCTGAAGAGCGGTGCGGATCTGGAGAAGGCTCAGGGACTGGAGCCT
ATCACTCTCTCGGTCGACGGCATGACGTGCTCCGGCTGCGGAATCAAGATGGAGCGCGTCCTTAAGGCCCAGGCG
GGCGTCTCTTCGGTCCGAGTCAACTTCGTCATGGGTTCGGCCGAGCTCAGCCTCGACACATCCATCACCTCCCCA
GATGGCCTCGTGCGAGCCGCAGAACGAGGCTCCGGCTTCCGCTGTACGAGGCTTTCCAGCGACGACCAGGCCATC
GACTTTCTGGCTGCCGGCCCCTCGGCCAAGGCGCTGGTCAATGCCACGATACCAGGCGTCAGGGAGACGACCATG
GTCAGCAGCCGAGTCGTTCGCGTCACATACGATCCCGCCGTCATCGGGGCCAGGGCCTTGATGAGACAGGTCGGC
CCCTTTTCCAGCGGTCTCGCACCCCCCGTGGACGACGCGGGCGTGTCGAGCGGCAGGAGGAGGCTCCGCGATGGG
CTCATCAAGACGACGGCTTCTGCTTGCTGTACGCTACCCATCGTCATCATGGCCTGGTCGGAGAAGCTAGTGGAT
GCCTGGACAGAGGCCCTGACGGCCATGGTATTGGCCACTGTCGTGCAGCTCATTGCCGTACCCGACTTTTACTTG
CCGGCCACCCGCGCCCTCCTCCACAGCGGCTCGCTCGAGATGGACATGCTGGTCGTCATCAGCATCACGGCCGCG
TATACCTACTCTGTCGTTGCCTTTGGATTCTTCATGGCTGGACGGCCTCTCGAGGTCGGTGCCCTGTTCGAGACG
AGCACGCTGCTCGTGACACTCGTTCTCCTCGGCCGTCTCGTGGCCGCCTTTGCCCGCCTCAGAGCGGTAGCTGCT
GTCTCGCTCCGATCTCTTCAAGCGGCCACATGCGTCATCGTCGAGGACGGCAAGGATCGAGAGATGGACTCGCGC
CTCTTGCAGTACGGAGACGAGCTCAAGATTGGCGCTCATGCGGCCGTGCCTACCGACGCGACCGTCATCGGCGGG
ATAAGCGAGGTGGATGAGTCCATCATCACGGGCGAGAGCTTGCCTGTGACCAAGAAGCCGGGCGACATGGTCATC
GCCGGCACTGTCAACGGCTCGGGCATGCTGAGGGCCCGGCTGAGGCGTCTCCCCGGGAAGAACACGGTGACCGAC
ATTGCCCGGCTCGTCGAGGAGGCAGCGAGCTCCCGGCCCAAGATTCAGGAGACGGCCGATGGCGTTGCCAGCTGG
TTCGTTCCCGTCGTTACGGCCATTGCCCTGATTGTCATCATCGTCTGGATCGTCGTGGGCCTCAAGGTGCGTGGG
TACGGCGCAGGAGAGGCCGTGGCCAATGCCATGACGTATGCCGTCGCCACGCTGGCCGTCTCGTGTCCCTGTGCG
CTCGGACTGGCTGTTCCGATGGTGCTGGTCGTTGCCGGTGGCATCGCTGCTCGCAACGGGGTCATCATCAAGTCG
GCTGGCTGTACTGAGCGCTCCCGCAAGGTGACGGACGTGGTGCTGGACAAGACGGGGACCATTACCGAAGCCGCG
CTCGACGTCACGAGCGAGCAGTTCTTTGCGTCGGCGAGCCGGGACGAGGCCATGGCCGTATCAAAGGCACTCGTC
GCCGACTCTCGACATCCCGTATCACTGGCCGTCGCCAAACACCTCGAGGAGCGGTCCGTGACGCCGGCCAGGCTG
ACGGACACGCGCGTCATCCCCGGATCCGGCGTCAAGGGCGTCTTGAGGGGCTCGACGGTCTGCGCCGGGAACGCG
TCATGGACCGAGACGGGGCATCATCCTGCCGTCGTCCGGCTGCTGGAGCGCGGCCTGACGCTCCTCGTCGTGACG
CGCGACGGCGAGCCCCTGGCCGTCTTCGGCATGCGGACCAAGCTCCGGTCCGAGGCGGCCGGAGTCGTCTCCCAG
CTCCATCGACAAAAGATTGTCGTCCACGTCGTCTCGGGCGATCACAAGGGCGCCGTCGACGCCGTGGCAGCCCAG
GTCGGCATCTCGCATGTCGTCTCCCAGTGCTCGCCGGCCGACAAGCGCGACTACGTGGCCGAGCTCATGTCTCGC
GGGCGGTACGTCATGTTCGTCGGCGACGGGACCAACGATGCCATTGCCGTGGCCCAGGCCGACGTGGGCGTACAG
CTGGCCAGCGTCGAGTCCTCCAGCGAGGTGACGAGAGGCGCTGCCGACGTCGTTCTCCTCAACGGCCTCGAGGGC
ATTCGCTTTCTGCTGCGCATCAGCGCCGTCAGCTTCCGCCGTATCGTCTTCAACTTTGTCTGGTCGGCCGCCTAC
AACGTGCTGGCTATTCTCCTTGCCTCGGGTGCCCTGGTCGACGTGCGCATCCCCCCGGCCTATGCCGGCCTCGGC
GAGATCGTCAGCGTCCTTCCCGTCATCTTGGCCGCCGTGACGATGCTGTGGAAGGGGATAAGGGCCGATGGTGCC
Transcript >Ophio5|7351
ATGGCCTTCGGAAACTGCTGCTCGCACGACCATGATGACGCTGTTGCCTCTCGTCTCGAGCCTGCAGCCCAAGAT
GATAGCCTTATGGAGGAGGAGGAGGAGGAGTGCCGTAACGGAGAAAGCTGCTGCGAGGGGGTCACACCCAGGCGG
TCGTCGACCGTCACCGGCTGCGACTTGGAGGAGGAGCCCTGCGATAGCTACCCAGAGAAATGCATTCTCAAGATT
GCCACCATCGAGTGCGAGCAGAGGCGCGGAGACGGCTTGGATGGCACGACCGGTAAGGGGCACGAACACGACACA
GACGGCAACCATCCGACCTCAGCCTGCCGCAACCACCGAGTCGAGGCCTTTGAGCGATACAGCGCCTACCTCGAG
TCGGCCCGCTGCATCTGCGACAGCGTCTTGGAGCAGGGCTGGTCCGAGGGCTGCTGTGACGAGCGGCAGCCCAAG
GGGCGCGCGACAACGATGAGCCCCGGCGAACACCCGAATGCATACTATGCGAGCAGCCGAGTCCTCCGCGGCCAC
CATGGCGTGAAACGCCGCCATAGGCATAGTGTTAGCAGGGACGGCTGCTGCGGCTCAGACGACGAGCACCATCGC
GAGCCGGTCCTCGACATGTGTGCTGCGGCCCTGAAGAGCGGTGCGGATCTGGAGAAGGCTCAGGGACTGGAGCCT
ATCACTCTCTCGGTCGACGGCATGACGTGCTCCGGCTGCGGAATCAAGATGGAGCGCGTCCTTAAGGCCCAGGCG
GGCGTCTCTTCGGTCCGAGTCAACTTCGTCATGGGTTCGGCCGAGCTCAGCCTCGACACATCCATCACCTCCCCA
GATGGCCTCGTGCGAGCCGCAGAACGAGGCTCCGGCTTCCGCTGTACGAGGCTTTCCAGCGACGACCAGGCCATC
GACTTTCTGGCTGCCGGCCCCTCGGCCAAGGCGCTGGTCAATGCCACGATACCAGGCGTCAGGGAGACGACCATG
GTCAGCAGCCGAGTCGTTCGCGTCACATACGATCCCGCCGTCATCGGGGCCAGGGCCTTGATGAGACAGGTCGGC
CCCTTTTCCAGCGGTCTCGCACCCCCCGTGGACGACGCGGGCGTGTCGAGCGGCAGGAGGAGGCTCCGCGATGGG
CTCATCAAGACGACGGCTTCTGCTTGCTGTACGCTACCCATCGTCATCATGGCCTGGTCGGAGAAGCTAGTGGAT
GCCTGGACAGAGGCCCTGACGGCCATGGTATTGGCCACTGTCGTGCAGCTCATTGCCGTACCCGACTTTTACTTG
CCGGCCACCCGCGCCCTCCTCCACAGCGGCTCGCTCGAGATGGACATGCTGGTCGTCATCAGCATCACGGCCGCG
TATACCTACTCTGTCGTTGCCTTTGGATTCTTCATGGCTGGACGGCCTCTCGAGGTCGGTGCCCTGTTCGAGACG
AGCACGCTGCTCGTGACACTCGTTCTCCTCGGCCGTCTCGTGGCCGCCTTTGCCCGCCTCAGAGCGGTAGCTGCT
GTCTCGCTCCGATCTCTTCAAGCGGCCACATGCGTCATCGTCGAGGACGGCAAGGATCGAGAGATGGACTCGCGC
CTCTTGCAGTACGGAGACGAGCTCAAGATTGGCGCTCATGCGGCCGTGCCTACCGACGCGACCGTCATCGGCGGG
ATAAGCGAGGTGGATGAGTCCATCATCACGGGCGAGAGCTTGCCTGTGACCAAGAAGCCGGGCGACATGGTCATC
GCCGGCACTGTCAACGGCTCGGGCATGCTGAGGGCCCGGCTGAGGCGTCTCCCCGGGAAGAACACGGTGACCGAC
ATTGCCCGGCTCGTCGAGGAGGCAGCGAGCTCCCGGCCCAAGATTCAGGAGACGGCCGATGGCGTTGCCAGCTGG
TTCGTTCCCGTCGTTACGGCCATTGCCCTGATTGTCATCATCGTCTGGATCGTCGTGGGCCTCAAGGTGCGTGGG
TACGGCGCAGGAGAGGCCGTGGCCAATGCCATGACGTATGCCGTCGCCACGCTGGCCGTCTCGTGTCCCTGTGCG
CTCGGACTGGCTGTTCCGATGGTGCTGGTCGTTGCCGGTGGCATCGCTGCTCGCAACGGGGTCATCATCAAGTCG
GCTGGCTGTACTGAGCGCTCCCGCAAGGTGACGGACGTGGTGCTGGACAAGACGGGGACCATTACCGAAGCCGCG
CTCGACGTCACGAGCGAGCAGTTCTTTGCGTCGGCGAGCCGGGACGAGGCCATGGCCGTATCAAAGGCACTCGTC
GCCGACTCTCGACATCCCGTATCACTGGCCGTCGCCAAACACCTCGAGGAGCGGTCCGTGACGCCGGCCAGGCTG
ACGGACACGCGCGTCATCCCCGGATCCGGCGTCAAGGGCGTCTTGAGGGGCTCGACGGTCTGCGCCGGGAACGCG
TCATGGACCGAGACGGGGCATCATCCTGCCGTCGTCCGGCTGCTGGAGCGCGGCCTGACGCTCCTCGTCGTGACG
CGCGACGGCGAGCCCCTGGCCGTCTTCGGCATGCGGACCAAGCTCCGGTCCGAGGCGGCCGGAGTCGTCTCCCAG
CTCCATCGACAAAAGATTGTCGTCCACGTCGTCTCGGGCGATCACAAGGGCGCCGTCGACGCCGTGGCAGCCCAG
GTCGGCATCTCGCATGTCGTCTCCCAGTGCTCGCCGGCCGACAAGCGCGACTACGTGGCCGAGCTCATGTCTCGC
GGGCGGTACGTCATGTTCGTCGGCGACGGGACCAACGATGCCATTGCCGTGGCCCAGGCCGACGTGGGCGTACAG
CTGGCCAGCGTCGAGTCCTCCAGCGAGGTGACGAGAGGCGCTGCCGACGTCGTTCTCCTCAACGGCCTCGAGGGC
ATTCGCTTTCTGCTGCGCATCAGCGCCGTCAGCTTCCGCCGTATCGTCTTCAACTTTGTCTGGTCGGCCGCCTAC
AACGTGCTGGCTATTCTCCTTGCCTCGGGTGCCCTGGTCGACGTGCGCATCCCCCCGGCCTATGCCGGCCTCGGC
GAGATCGTCAGCGTCCTTCCCGTCATCTTGGCCGCCGTGACGATGCTGTGGAAGGGGATAAGGGCCGATGGTGCC
TGA
Gene >Ophio5|7351
ATGGCCTTCGGAAACTGCTGCTCGCACGACCATGATGACGCTGTTGCCTCTCGTCTCGAGCCTGCAGCCCAAGAT
GATAGCCTTATGGAGGAGGAGGAGGAGGAGTGCCGTAACGGAGAAAGCTGCTGCGAGGGGGTCACACCCAGGCGG
TCGTCGACCGTCACCGGCTGCGACTTGGAGGAGGAGCCCTGCGATAGTTTGTCCCAGCCAAAGGTCTCTCTTCCC
TCTCGACAGGCATCTGACGTCCGAGCCAAGGCTACCCAGAGAAATGCATTCTCAAGATTGCCACCATCGAGTGCG
AGCAGAGGCGCGGAGACGGCTTGGATGGTAAGTATCGTTTGCTTCCCAGCAACGGGCAGTTTGCACCAGCTACCT
ACCTACCTACCTACCTACCTACCTACCTCCTTCTTTACATACGTGTCTTCTATAGAGGCGGCTTCTGTCCGTCTT
CCTTCTGAAAGCTGCTCACGCGTTCCATACTACAGGCACGACCGGTAAGGGGCACGAACACGACACAGACGGCAA
CCATCCGACCTCAGCCTGCCGCAACCACCGAGTCGAGGCCTTTGAGCGATACAGCGCCTACCTCGAGTCGGCCCG
CTGCATCTGCGACAGCGTCTTGGAGCAGGGCTGGTCCGAGGGCTGCTGTGACGAGCGGCAGCCCAAGGGGCGCGC
GACAACGATGAGCCCCGGCGAACACCCGAATGCATACTATGCGAGCAGCCGAGTCCTCCGCGGCCACCATGGCGT
GAAACGCCGCCATAGGCATAGTGTTAGCAGGGACGGCTGCTGCGGCTCAGACGACGAGCACCATCGCGAGCCGGT
CCTCGACATGTGTGCTGCGGCCCTGAAGAGCGGTGCGGATCTGGAGAAGGCTCAGGGACTGGAGCCTATCACTCT
CTCGGTCGACGGCATGACGTGCTCCGGCTGCGGAATCAAGATGGAGCGCGTCCTTAAGGCCCAGGCGGGCGTCTC
TTCGGTCCGAGTCAACTTCGTCATGGGTTCGGCCGAGCTCAGCCTCGACACATCCATCACCTCCCCAGATGGCCT
CGTGCGAGCCGCAGAACGAGGCTCCGGCTTCCGCTGTACGAGGCTTTCCAGCGACGACCAGGCCATCGACTTTCT
GGCTGCCGGCCCCTCGGCCAAGGCGCTGGTCAATGCCACGATACCAGGCGTCAGGGAGACGACCATGGTCAGCAG
CCGAGTCGTTCGCGTCACATACGATCCCGCCGTCATCGGGGCCAGGGCCTTGATGAGACAGGTCGGCCCCTTTTC
CAGCGGTCTCGCACCCCCCGTGGACGACGCGGGCGTGTCGAGCGGCAGGAGGAGGCTCCGCGATGGGCTCATCAA
GACGACGGCTTCTGCTTGCTGTACGCTACCCATCGTCATCATGGCCTGGTCGGAGAAGCTAGTGGATGCCTGGAC
AGAGGCCCTGACGGCCATGGTATTGGCCACTGTCGTGCAGCTCATTGCCGTACCCGACTTTTACTTGCCGGCCAC
CCGCGCCCTCCTCCACAGCGGCTCGCTCGAGATGGACATGCTGGTCGTCATCAGCATCACGGCCGCGTATACCTA
CTCTGTCGTTGCCTTTGGATTCTTCATGGCTGGACGGCCTCTCGAGGTCGGTGCCCTGTTCGAGACGAGCACGCT
GCTCGTGACACTCGTTCTCCTCGGCCGTCTCGTGGCCGCCTTTGCCCGCCTCAGAGCGGTAGCTGCTGTCTCGCT
CCGATCTCTTCAAGCGGCCACATGCGTCATCGTCGAGGACGGCAAGGATCGAGAGATGGACTCGCGCCTCTTGCA
GTACGGAGACGAGCTCAAGATTGGCGCTCATGCGGCCGTGCCTACCGACGCGACCGTCATCGGCGGGATAAGCGA
GGTGGATGAGTCCATCATCACGGGCGAGAGCTTGCCTGTGACCAAGAAGCCGGGCGACATGGTCATCGCCGGCAC
TGTCAACGGCTCGGGCATGCTGAGGGCCCGGCTGAGGCGTCTCCCCGGGAAGAACACGGTGACCGACATTGCCCG
GCTCGTCGAGGAGGCAGCGAGCTCCCGGCCCAAGATTCAGGAGACGGCCGATGGCGTTGCCAGCTGGTTCGTTCC
CGTCGTTACGGCCATTGCCCTGATTGTCATCATCGTCTGGATCGTCGTGGGCCTCAAGGTGCGTGGGTACGGCGC
AGGAGAGGCCGTGGCCAATGCCATGACGTATGCCGTCGCCACGCTGGCCGTCTCGTGTCCCTGTGCGCTCGGACT
GGCTGTTCCGATGGTGCTGGTCGTTGCCGGTGGCATCGCTGCTCGCAACGGGGTCATCATCAAGTCGGCTGGCTG
TACTGAGCGCTCCCGCAAGGTGACGGACGTGGTGCTGGACAAGACGGGGACCATTACCGAAGCCGCGCTCGACGT
CACGAGCGAGCAGTTCTTTGCGTCGGCGAGCCGGGACGAGGCCATGGCCGTATCAAAGGCACTCGTCGCCGACTC
TCGACATCCCGTATCACTGGCCGTCGCCAAACACCTCGAGGAGCGGTCCGTGACGCCGGCCAGGCTGACGGACAC
GCGCGTCATCCCCGGATCCGGCGTCAAGGGCGTCTTGAGGGGCTCGACGGTCTGCGCCGGGAACGCGTCATGGAC
CGAGACGGGGCATCATCCTGCCGTCGTCCGGCTGCTGGAGCGCGGCCTGACGCTCCTCGTCGTGACGCGCGACGG
CGAGCCCCTGGCCGTCTTCGGCATGCGGACCAAGCTCCGGTCCGAGGCGGCCGGAGTCGTCTCCCAGCTCCATCG
ACAAAAGATTGTCGTCCACGTCGTCTCGGGCGATCACAAGGGCGCCGTCGACGCCGTGGCAGCCCAGGTCGGCAT
CTCGCATGTCGTCTCCCAGTGCTCGCCGGCCGACAAGCGCGACTACGTGGCCGAGCTCATGTCTCGCGGGCGGTA
CGTCATGTTCGTCGGCGACGGGACCAACGATGCCATTGCCGTGGCCCAGGCCGACGTGGGCGTACAGCTGGCCAG
CGTCGAGTCCTCCAGCGAGGTGACGAGAGGCGCTGCCGACGTCGTTCTCCTCAACGGCCTCGAGGGCATTCGCTT
TCTGCTGCGCATCAGCGCCGTCAGCTTCCGCCGTATCGTCTTCAACTTTGTCTGGTCGGCCGCCTACAACGTGCT
GGCTATTCTCCTTGCCTCGGGTGCCCTGGTCGACGTGCGCATCCCCCCGGCCTATGCCGGCCTCGGCGAGATCGT
CAGCGTCCTTCCCGTCATCTTGGCCGCCGTGACGATGCTGTGGAAGGGGATAAGGGCCGATGGTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail