Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7346
Gene name
Locationscaffold_70:29166..30711
Strand+
Gene length (bp)1545
Transcript length (bp)1380
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 1.9E-57 59 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 5 441 6.0E-104
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 5 441 1.0E-103
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 5 441 1.0E-103
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 5 441 2.0E-102
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 5 441 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 5 441 6.0E-104
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 5 441 1.0E-103
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 5 441 1.0E-103
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 5 441 2.0E-102
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 5 441 2.0E-102
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 1 459 7.0E-97
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 6 372 9.0E-96
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 20 459 1.0E-92
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 22 459 1.0E-88
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 18 455 1.0E-86
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 14 374 1.0E-86
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 15 456 8.0E-83
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 25 413 4.0E-79
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 25 438 5.0E-78
sp|O74922|AMY1_SCHPO Alpha-amylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=3 SV=1 6 374 1.0E-72
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 17 456 1.0E-71
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 23 426 2.0E-71
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 25 433 3.0E-40
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 7 433 2.0E-39
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 30 442 1.0E-38
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 30 434 2.0E-38
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 7 433 3.0E-38
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 30 433 5.0E-38
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 15 431 2.0E-37
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 1 442 2.0E-37
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 16 430 3.0E-36
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 7 433 1.0E-35
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 30 373 3.0E-35
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 26 433 4.0E-35
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 30 433 1.0E-34
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 30 433 2.0E-34
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 25 433 6.0E-34
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 21 448 6.0E-34
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 30 433 9.0E-34
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 22 383 5.0E-33
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 56 383 2.0E-32
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 56 425 2.0E-31
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 22 418 7.0E-31
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 2 418 1.0E-28
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 6 413 2.0E-28
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 7 433 3.0E-28
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 24 387 2.0E-26
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 56 381 7.0E-25
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 56 389 8.0E-25
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 1 366 1.0E-23
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 7 135 4.0E-23
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 139 456 1.0E-22
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 56 398 1.0E-19
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 25 334 4.0E-19
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 56 385 1.0E-18
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 51 339 5.0E-18
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 54 135 7.0E-18
sp|P08117|AMY3_WHEAT Alpha-amylase AMY3 OS=Triticum aestivum GN=AMY1.1 PE=2 SV=1 58 331 7.0E-16
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 145 417 2.0E-15
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 56 396 9.0E-15
sp|P21517|MALZ_ECOLI Maltodextrin glucosidase OS=Escherichia coli (strain K12) GN=malZ PE=1 SV=5 56 418 1.0E-14
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 56 458 2.0E-14
sp|P80099|MGTA_THEMA 4-alpha-glucanotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mgtA PE=1 SV=2 59 347 2.0E-14
sp|O86956|MGTA_THENE 4-alpha-glucanotransferase OS=Thermotoga neapolitana GN=mgtA PE=1 SV=1 59 361 5.0E-14
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 56 458 7.0E-14
sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 51 331 8.0E-14
sp|P27934|AMY3E_ORYSJ Alpha-amylase isozyme 3E OS=Oryza sativa subsp. japonica GN=AMY1.4 PE=2 SV=1 51 383 1.0E-13
sp|Q8VZ56|AMY1_ARATH Alpha-amylase 1 OS=Arabidopsis thaliana GN=AMY1 PE=1 SV=1 27 331 5.0E-13
sp|P06278|AMY_BACLI Alpha-amylase OS=Bacillus licheniformis GN=amyS PE=1 SV=1 58 458 1.0E-12
sp|Q8LFG1|AMY2_ARATH Probable alpha-amylase 2 OS=Arabidopsis thaliana GN=AMY2 PE=2 SV=1 64 331 1.0E-12
sp|P27939|AMY3C_ORYSJ Alpha-amylase isozyme 3C OS=Oryza sativa subsp. japonica GN=AMY1.7 PE=2 SV=2 51 331 2.0E-12
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 59 211 2.0E-12
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 59 396 3.0E-12
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 59 217 3.0E-12
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 64 236 5.0E-12
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 59 216 7.0E-12
sp|P04750|AMY6_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.6 PE=2 SV=2 51 217 1.0E-11
sp|P27937|AMY3B_ORYSJ Alpha-amylase isozyme 3B OS=Oryza sativa subsp. japonica GN=AMY1.6 PE=2 SV=1 51 331 1.0E-11
sp|Q60053|NEPU1_THEVU Neopullulanase 1 OS=Thermoactinomyces vulgaris GN=tvaI PE=1 SV=1 56 395 1.0E-11
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 15 217 2.0E-11
sp|P43473|AGL_PEDPE Alpha-glucosidase OS=Pediococcus pentosaceus GN=agl PE=3 SV=1 59 216 2.0E-11
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 14 135 2.0E-11
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 14 135 2.0E-11
sp|P17654|AMY1_ORYSJ Alpha-amylase OS=Oryza sativa subsp. japonica GN=AMY1.1 PE=1 SV=2 51 331 2.0E-11
sp|P00693|AMY1_HORVU Alpha-amylase type A isozyme OS=Hordeum vulgare GN=AMY1.1 PE=1 SV=1 51 331 3.0E-11
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 59 263 3.0E-11
sp|P95867|TREZ_SULSO Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=treZ PE=1 SV=1 59 211 3.0E-11
sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 58 331 5.0E-11
sp|Q9NJN8|AMYR_DROBP Alpha-amylase-related protein OS=Drosophila bipectinata GN=Amyrel PE=3 SV=1 69 302 8.0E-11
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 59 216 1.0E-10
sp|Q23835|AMY1_DROAN Alpha-amylase 1 OS=Drosophila ananassae GN=Amy35 PE=3 SV=3 69 302 1.0E-10
sp|O18345|AMY2_DROAN Alpha-amylase 2 OS=Drosophila ananassae GN=Amy58 PE=3 SV=2 69 302 1.0E-10
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 59 135 2.0E-10
sp|O77020|AMYR_DROAV Alpha-amylase-related protein OS=Drosophila auraria GN=Amyrel PE=3 SV=2 65 302 2.0E-10
sp|Q23834|AM4N_DROAN Alpha-amylase 4N OS=Drosophila ananassae GN=Amy4N PE=3 SV=2 69 302 2.0E-10
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 21 135 2.0E-10
sp|P04747|AMY3_HORVU Alpha-amylase type B isozyme (Fragment) OS=Hordeum vulgare GN=AMY1.3 PE=2 SV=1 51 217 2.0E-10
sp|P04063|AMY2_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.2 PE=1 SV=3 51 217 2.0E-10
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 59 216 3.0E-10
sp|Q0D9J1|AMY2A_ORYSJ Alpha-amylase isozyme 2A OS=Oryza sativa subsp. japonica GN=AMY2A PE=2 SV=1 51 331 4.0E-10
sp|A2YGY2|AMY2A_ORYSI Alpha-amylase isozyme 2A OS=Oryza sativa subsp. indica GN=AMYC2 PE=2 SV=1 51 331 4.0E-10
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 59 216 4.0E-10
sp|P9WQ21|TREY_MYCTU Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treY PE=1 SV=1 58 143 5.0E-10
sp|P9WQ20|TREY_MYCTO Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treY PE=3 SV=1 58 143 5.0E-10
sp|O77011|AMYR_DROAP Alpha-amylase-related protein OS=Drosophila atripex GN=Amyrel PE=3 SV=3 70 302 5.0E-10
sp|O18344|AMYR_DROAN Alpha-amylase-related protein OS=Drosophila ananassae GN=Amyrel PE=3 SV=2 69 302 7.0E-10
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 59 216 8.0E-10
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 6 249 8.0E-10
sp|O77018|AMYR_DROTK Alpha-amylase-related protein OS=Drosophila takahashii GN=Amyrel PE=3 SV=2 70 302 9.0E-10
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 60 214 9.0E-10
sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 59 214 2.0E-09
sp|O77012|AMYR_DROEC Alpha-amylase-related protein OS=Drosophila ercepeae GN=Amyrel PE=3 SV=2 69 302 2.0E-09
sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 59 217 2.0E-09
sp|O77016|AMYR_DROSI Alpha-amylase-related protein OS=Drosophila simulans GN=Amyrel PE=3 SV=3 70 302 3.0E-09
sp|O76260|AMYR_DROTE Alpha-amylase-related protein OS=Drosophila teissieri GN=Amyrel PE=3 SV=2 70 302 3.0E-09
sp|Q9NJN7|AMYR_DROVA Alpha-amylase-related protein OS=Drosophila varians GN=Amyrel PE=3 SV=1 75 302 3.0E-09
sp|O77014|AMYR_DROMA Alpha-amylase-related protein OS=Drosophila mauritiana GN=Amyrel PE=3 SV=2 70 302 3.0E-09
sp|O76261|AMYR_DROSE Alpha-amylase-related protein OS=Drosophila sechellia GN=Amyrel PE=3 SV=1 70 302 3.0E-09
sp|Q9RQI5|GLGB_BERDE 1,4-alpha-glucan branching enzyme GlgB OS=Bergeriella denitrificans GN=glgB PE=3 SV=1 60 211 4.0E-09
sp|O76262|AMYR_DROLN Alpha-amylase-related protein OS=Drosophila lini GN=Amyrel PE=3 SV=2 70 302 4.0E-09
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 59 137 4.0E-09
sp|O18408|AMYR_DROME Alpha-amylase-related protein OS=Drosophila melanogaster GN=Amyrel PE=2 SV=2 70 302 5.0E-09
sp|O77019|AMYR_DROBA Alpha-amylase-related protein OS=Drosophila bakoue GN=Amyrel PE=3 SV=2 70 302 9.0E-09
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 59 135 1.0E-08
sp|Q82JF0|GLGB1_STRAW 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB1 PE=3 SV=1 58 211 1.0E-08
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 59 336 1.0E-08
sp|P07190|MAL1_DROME Maltase A1 OS=Drosophila melanogaster GN=Mal-A1 PE=2 SV=2 22 135 1.0E-08
sp|Q6CX53|GLGB_KLULA 1,4-alpha-glucan-branching enzyme OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLC3 PE=3 SV=1 45 211 1.0E-08
sp|O97396|AMY_PHACE Alpha-amylase OS=Phaedon cochleariae PE=2 SV=1 69 302 1.0E-08
sp|P29957|AMY_PSEHA Alpha-amylase OS=Pseudoalteromonas haloplanktis GN=amy PE=1 SV=3 70 302 2.0E-08
sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=1 SV=1 68 211 2.0E-08
sp|Q54796|DEXB_STRPN Glucan 1,6-alpha-glucosidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dexB PE=3 SV=2 59 216 2.0E-08
sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 68 211 2.0E-08
sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 58 208 2.0E-08
sp|Q8NR40|GLGB_CORGL 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glgB PE=3 SV=1 40 211 2.0E-08
sp|Q825Q8|GLGB2_STRAW 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB2 PE=3 SV=1 58 211 3.0E-08
sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 68 211 3.0E-08
sp|Q8NKE1|GLGB_RHIID 1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GLC3 PE=2 SV=2 59 211 3.0E-08
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 59 135 3.0E-08
sp|Q91WV7|SLC31_MOUSE Neutral and basic amino acid transport protein rBAT OS=Mus musculus GN=Slc3a1 PE=1 SV=1 59 208 4.0E-08
sp|A4Y4U3|GLGB_SHEPC 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glgB PE=3 SV=1 64 211 4.0E-08
sp|P72235|TRES_PIMSR Trehalose synthase OS=Pimelobacter sp. (strain R48) GN=treS PE=3 SV=1 59 135 5.0E-08
sp|P27350|AMY_STRTL Alpha-amylase OS=Streptomyces thermoviolaceus GN=amy PE=3 SV=2 101 321 6.0E-08
sp|O18420|AMYR_DROSU Alpha-amylase-related protein OS=Drosophila subobscura GN=Amyrel PE=3 SV=1 65 302 7.0E-08
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 59 204 8.0E-08
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 60 250 8.0E-08
sp|P30270|AMY_STRGR Alpha-amylase OS=Streptomyces griseus GN=amy PE=3 SV=1 101 456 8.0E-08
sp|Q2W2Q6|GLGB_MAGSA 1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgB PE=3 SV=1 69 211 9.0E-08
sp|Q9RX51|TREZ_DEIRA Malto-oligosyltrehalose trehalohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=treZ PE=1 SV=1 59 217 1.0E-07
sp|P9WN45|GLGB_MYCTU 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgB PE=1 SV=1 34 211 1.0E-07
sp|A5U226|GLGB_MYCTA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glgB PE=3 SV=1 34 211 1.0E-07
sp|P9WN44|GLGB_MYCTO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgB PE=3 SV=1 34 211 1.0E-07
sp|A1KIB6|GLGB_MYCBP 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glgB PE=3 SV=1 34 211 1.0E-07
sp|P59816|GLGB_MYCBO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgB PE=3 SV=1 34 211 1.0E-07
sp|P52980|GLGB_STRAU 1,4-alpha-glucan branching enzyme GlgB OS=Streptomyces aureofaciens GN=glgB PE=3 SV=1 58 211 1.0E-07
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 59 214 1.0E-07
sp|P28904|TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) GN=treC PE=3 SV=3 59 341 1.0E-07
sp|A8G3V0|GLGB_PROM2 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9215) GN=glgB PE=3 SV=1 60 211 1.0E-07
sp|Q8FQ12|GLGB_COREF 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glgB PE=3 SV=1 58 211 1.0E-07
sp|Q555Q9|GLGB_DICDI 1,4-alpha-glucan-branching enzyme OS=Dictyostelium discoideum GN=glgB PE=3 SV=1 65 211 2.0E-07
sp|Q9NJP0|AMYR_DROEL Alpha-amylase-related protein OS=Drosophila elegans GN=Amyrel PE=3 SV=2 65 302 2.0E-07
sp|Q59833|GLGB1_STRCO 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB1 PE=3 SV=2 58 211 2.0E-07
sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 68 211 2.0E-07
sp|A1RLX8|GLGB_SHESW 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain W3-18-1) GN=glgB PE=3 SV=1 64 211 2.0E-07
sp|Q081Q4|GLGB_SHEFN 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella frigidimarina (strain NCIMB 400) GN=glgB PE=3 SV=1 70 211 2.0E-07
sp|Q0HST5|GLGB_SHESR 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-7) GN=glgB PE=3 SV=1 64 211 2.0E-07
sp|Q59832|GLGB2_STRCO 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB2 PE=3 SV=2 58 211 2.0E-07
sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 58 208 2.0E-07
sp|Q31BV0|GLGB_PROM9 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9312) GN=glgB PE=3 SV=1 60 211 2.0E-07
sp|Q0HGI8|GLGB_SHESM 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-4) GN=glgB PE=3 SV=1 64 211 2.0E-07
sp|Q3SH78|GLGB_THIDA 1,4-alpha-glucan branching enzyme GlgB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=glgB PE=3 SV=1 68 211 3.0E-07
sp|O18552|AMYR_DROPS Alpha-amylase-related protein OS=Drosophila pseudoobscura pseudoobscura GN=Amyrel PE=3 SV=2 65 302 3.0E-07
sp|Q6AEU4|GLGB_LEIXX 1,4-alpha-glucan branching enzyme GlgB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgB PE=3 SV=1 68 211 3.0E-07
sp|P0CW41|MALX4_YEAST Oligo-1,6-glucosidase IMA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA4 PE=3 SV=1 59 209 3.0E-07
sp|P0CW40|MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA3 PE=1 SV=1 59 209 3.0E-07
sp|Q73X75|GLGB_MYCPA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glgB PE=3 SV=1 34 211 3.0E-07
sp|P53051|MALX3_YEAST Oligo-1,6-glucosidase IMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA1 PE=1 SV=1 59 209 3.0E-07
sp|Q99040|DEXB_STRMU Glucan 1,6-alpha-glucosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dexB PE=1 SV=2 59 216 4.0E-07
sp|Q08295|IMA2_YEAST Oligo-1,6-glucosidase IMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA2 PE=2 SV=1 59 209 4.0E-07
sp|Q757Q6|GLGB_ASHGO 1,4-alpha-glucan-branching enzyme OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLC3 PE=3 SV=1 45 211 4.0E-07
sp|P06279|AMY_GEOSE Alpha-amylase OS=Geobacillus stearothermophilus GN=amyS PE=1 SV=3 178 349 4.0E-07
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 59 211 5.0E-07
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 101 456 5.0E-07
sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 16 217 5.0E-07
sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 68 211 5.0E-07
sp|A6WKY2|GLGB_SHEB8 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS185) GN=glgB PE=3 SV=1 64 211 6.0E-07
sp|A3D286|GLGB_SHEB5 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glgB PE=3 SV=1 64 211 6.0E-07
sp|A9KTJ1|GLGB_SHEB9 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS195) GN=glgB PE=3 SV=1 64 211 6.0E-07
sp|B8EAX1|GLGB_SHEB2 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS223) GN=glgB PE=3 SV=1 64 211 6.0E-07
sp|O76263|AMYR_DROWI Alpha-amylase-related protein OS=Drosophila willistoni GN=Amyrel PE=3 SV=1 75 302 6.0E-07
sp|Q7U646|GLGB_SYNPX 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain WH8102) GN=glgB PE=3 SV=1 60 211 7.0E-07
sp|A2BQ65|GLGB_PROMS 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain AS9601) GN=glgB PE=3 SV=1 60 211 7.0E-07
sp|A3PBV8|GLGB_PROM0 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9301) GN=glgB PE=3 SV=1 60 211 7.0E-07
sp|A2BVP7|GLGB_PROM5 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9515) GN=glgB PE=3 SV=1 60 211 7.0E-07
sp|P08486|AMY_STRHY Alpha-amylase OS=Streptomyces hygroscopicus PE=3 SV=1 69 214 7.0E-07
sp|A0R1Y4|GLGB_MYCS2 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glgB PE=3 SV=1 58 211 8.0E-07
sp|Q8EGU7|GLGB_SHEON 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella oneidensis (strain MR-1) GN=glgB PE=3 SV=2 64 211 8.0E-07
sp|P32775|GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC3 PE=1 SV=2 65 211 9.0E-07
sp|Q7V299|GLGB_PROMP 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glgB PE=3 SV=1 60 211 9.0E-07
sp|Q1WSM8|GLGB_LACS1 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus salivarius (strain UCC118) GN=glgB PE=3 SV=1 60 214 1.0E-06
sp|Q3AKV6|GLGB_SYNSC 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9605) GN=glgB PE=3 SV=1 60 211 1.0E-06
sp|Q2J6Q9|GLGB_FRASC 1,4-alpha-glucan branching enzyme GlgB OS=Frankia sp. (strain CcI3) GN=glgB PE=3 SV=1 33 211 1.0E-06
sp|Q3AYE2|GLGB_SYNS9 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9902) GN=glgB PE=3 SV=1 60 211 1.0E-06
sp|Q2YB47|GLGB_NITMU 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glgB PE=3 SV=1 55 211 1.0E-06
sp|P38158|MAL32_YEAST Alpha-glucosidase MAL32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL32 PE=1 SV=1 59 157 1.0E-06
sp|P53341|MAL12_YEAST Alpha-glucosidase MAL12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL12 PE=1 SV=1 59 157 1.0E-06
sp|Q47SE7|GLGB_THEFY 1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) GN=glgB PE=3 SV=1 40 211 1.0E-06
sp|P07265|MAL62_YEASX Alpha-glucosidase MAL62 OS=Saccharomyces cerevisiae GN=MAL62 PE=1 SV=1 59 157 1.0E-06
sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 68 211 1.0E-06
sp|Q5Z0W8|GLGB_NOCFA 1,4-alpha-glucan branching enzyme GlgB OS=Nocardia farcinica (strain IFM 10152) GN=glgB PE=3 SV=1 40 211 1.0E-06
sp|Q6FJV0|GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLC3 PE=3 SV=1 45 211 1.0E-06
sp|A9BAY7|GLGB_PROM4 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9211) GN=glgB PE=3 SV=1 60 211 1.0E-06
sp|B0BT96|GLGB_ACTPJ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glgB PE=3 SV=1 68 211 1.0E-06
sp|Q1D654|GLGB_MYXXD 1,4-alpha-glucan branching enzyme GlgB OS=Myxococcus xanthus (strain DK 1622) GN=glgB PE=3 SV=1 29 211 1.0E-06
sp|B3H0J1|GLGB_ACTP7 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgB PE=3 SV=1 68 211 1.0E-06
sp|Q6BXN1|GLGB_DEBHA 1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLC3 PE=3 SV=1 59 211 2.0E-06
sp|A0PUI6|GLGB_MYCUA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium ulcerans (strain Agy99) GN=glgB PE=3 SV=1 34 211 2.0E-06
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 69 214 4.0E-06
sp|O23647|GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.1 PE=2 SV=1 68 211 4.0E-06
sp|Q0I3H7|GLGB_HAES1 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus somnus (strain 129Pt) GN=glgB PE=3 SV=1 65 211 4.0E-06
sp|P56634|AMY_TENMO Alpha-amylase OS=Tenebrio molitor PE=1 SV=1 70 302 4.0E-06
sp|A3MZ64|GLGB_ACTP2 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgB PE=3 SV=1 68 211 4.0E-06
sp|B0UU89|GLGB_HISS2 1,4-alpha-glucan branching enzyme GlgB OS=Histophilus somni (strain 2336) GN=glgB PE=3 SV=1 65 211 4.0E-06
sp|P9WQ23|TREZ_MYCTU Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treZ PE=1 SV=1 58 137 4.0E-06
sp|P9WQ22|TREZ_MYCTO Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treZ PE=3 SV=1 58 137 4.0E-06
sp|Q7V8B5|GLGB_PROMM 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9313) GN=glgB PE=3 SV=1 60 211 5.0E-06
sp|A2CAR9|GLGB_PROM3 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9303) GN=glgB PE=3 SV=1 60 211 5.0E-06
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 68 211 5.0E-06
sp|P00692|AMY_BACAM Alpha-amylase OS=Bacillus amyloliquefaciens PE=1 SV=1 178 458 5.0E-06
sp|P53354|AMY1_AEDAE Alpha-amylase I OS=Aedes aegypti GN=AMY1 PE=2 SV=2 75 217 5.0E-06
sp|P30924|GLGB_SOLTU 1,4-alpha-glucan-branching enzyme OS=Solanum tuberosum GN=SBE1 PE=2 SV=2 68 211 6.0E-06
sp|O06458|TRES_THETH Trehalose synthase OS=Thermus thermophilus GN=treS PE=3 SV=1 59 135 7.0E-06
sp|P13507|AMT4_PSEST Glucan 1,4-alpha-maltotetraohydrolase OS=Pseudomonas stutzeri GN=amyP PE=1 SV=2 64 332 7.0E-06
sp|Q44316|TREZ_ARTSQ Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter sp. (strain Q36) GN=treZ PE=3 SV=1 59 217 7.0E-06
sp|A5GSG4|GLGB_SYNR3 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain RCC307) GN=glgB PE=3 SV=1 68 211 7.0E-06
sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 59 217 9.0E-06
sp|Q7VBL4|GLGB_PROMA 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glgB PE=3 SV=1 60 211 9.0E-06
sp|Q47II8|GLGB_DECAR 1,4-alpha-glucan branching enzyme GlgB OS=Dechloromonas aromatica (strain RCB) GN=glgB PE=3 SV=1 65 211 9.0E-06
sp|Q02751|MALT_CANAX Alpha-glucosidase OS=Candida albicans GN=MAL2 PE=1 SV=4 59 211 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7346
MKPSTLLSFVIQLSVPALAADATAWKSRSIYFALTDRIARNTTDGDRSPCYELGRYCGGTFSGLESKLDYIKDLG
FDAIWISPVIKNHDGGYHGYWAQDLYSINPNFGTADELKSLVNAAHSKDMYVMVDVVANHMGGPISQNRPEPLNQ
DWSYHTPCMINYGDQGSVEYCQIGGLPDLDTRNPQIRQLLYNWIHWLVEEFRFDGLRIDTVKHVEKDFWSGFSAA
AGVFTIGEAFDHRVDVLAGYSHVMSSLLNYAVFHPLNDFYMQRGSSQTLINTHDAVSWAFSDPSVLGTFIDNHDN
PRWLSQKNDHALLKNALTYVLLARGIPIVYYATEQGYAGGHDPANRESLWHTNFDTKGDLYRFISRVSRVRKAAG
GLPQNDHVHLMVEDTGYAWSRAGGDVIALTSNIGSGNSREYCLFTRRPHGVWKDVFEGKGYTADERGWMCAHIYG
GNPIILVSA
Coding >Ophio5|7346
ATGAAGCCCTCGACCTTGCTCTCATTCGTCATCCAGCTCTCCGTCCCTGCACTCGCAGCGGACGCGACAGCCTGG
AAGTCACGCAGCATCTACTTTGCCTTGACTGATCGAATCGCACGAAACACTACCGATGGCGATAGAAGCCCATGT
TACGAGCTGGGGAGGTACTGCGGAGGGACTTTTAGCGGCCTGGAGTCGAAGCTCGACTACATCAAAGATCTGGGC
TTTGACGCCATTTGGATCTCGCCCGTGATTAAAAACCATGATGGCGGCTATCACGGATACTGGGCCCAGGACTTG
TACTCGATCAACCCCAATTTCGGAACAGCTGATGAGCTCAAAAGCCTCGTCAATGCTGCACACAGCAAGGACATG
TATGTCATGGTGGATGTTGTCGCCAATCACATGGGCGGGCCTATCTCTCAGAACAGACCTGAGCCCTTGAATCAA
GACTGGTCATACCACACGCCGTGCATGATCAACTACGGAGACCAAGGCAGCGTGGAATACTGCCAAATCGGCGGT
CTGCCCGACCTCGACACTCGAAATCCGCAGATCCGCCAGTTGCTTTACAACTGGATTCACTGGCTTGTTGAGGAG
TTCCGGTTCGATGGTCTTCGGATTGACACGGTAAAGCATGTCGAGAAAGACTTCTGGTCGGGATTCTCGGCTGCC
GCTGGCGTCTTCACCATCGGAGAGGCGTTTGATCACCGCGTCGACGTCCTAGCAGGTTACTCACATGTCATGTCG
AGCCTGCTCAACTACGCCGTCTTTCACCCACTCAACGATTTCTACATGCAGAGAGGTTCGTCGCAGACACTCATC
AACACACACGATGCCGTCAGCTGGGCCTTTTCCGATCCGTCGGTGCTGGGGACATTCATAGACAATCACGATAAC
CCGAGATGGCTTAGCCAGAAGAACGACCACGCTCTGTTGAAGAACGCTCTTACCTACGTCCTTCTCGCCCGCGGC
ATCCCCATTGTCTATTATGCCACCGAGCAAGGATATGCCGGTGGCCATGACCCAGCGAATCGTGAGAGCCTCTGG
CATACCAACTTTGACACTAAAGGCGACCTGTATCGGTTCATCAGTCGGGTTTCCCGCGTACGAAAGGCCGCAGGG
GGGCTGCCGCAAAATGATCACGTCCACCTCATGGTTGAGGATACAGGCTACGCGTGGAGCCGTGCGGGTGGCGAC
GTGATTGCGCTGACGAGCAATATCGGAAGCGGAAACTCGAGGGAGTATTGTCTCTTTACGAGAAGGCCACATGGC
GTTTGGAAGGATGTGTTTGAGGGTAAAGGGTACACTGCTGATGAAAGAGGCTGGATGTGTGCCCATATCTACGGT
GGCAACCCAATTATTCTGGTTTCTGCT
Transcript >Ophio5|7346
ATGAAGCCCTCGACCTTGCTCTCATTCGTCATCCAGCTCTCCGTCCCTGCACTCGCAGCGGACGCGACAGCCTGG
AAGTCACGCAGCATCTACTTTGCCTTGACTGATCGAATCGCACGAAACACTACCGATGGCGATAGAAGCCCATGT
TACGAGCTGGGGAGGTACTGCGGAGGGACTTTTAGCGGCCTGGAGTCGAAGCTCGACTACATCAAAGATCTGGGC
TTTGACGCCATTTGGATCTCGCCCGTGATTAAAAACCATGATGGCGGCTATCACGGATACTGGGCCCAGGACTTG
TACTCGATCAACCCCAATTTCGGAACAGCTGATGAGCTCAAAAGCCTCGTCAATGCTGCACACAGCAAGGACATG
TATGTCATGGTGGATGTTGTCGCCAATCACATGGGCGGGCCTATCTCTCAGAACAGACCTGAGCCCTTGAATCAA
GACTGGTCATACCACACGCCGTGCATGATCAACTACGGAGACCAAGGCAGCGTGGAATACTGCCAAATCGGCGGT
CTGCCCGACCTCGACACTCGAAATCCGCAGATCCGCCAGTTGCTTTACAACTGGATTCACTGGCTTGTTGAGGAG
TTCCGGTTCGATGGTCTTCGGATTGACACGGTAAAGCATGTCGAGAAAGACTTCTGGTCGGGATTCTCGGCTGCC
GCTGGCGTCTTCACCATCGGAGAGGCGTTTGATCACCGCGTCGACGTCCTAGCAGGTTACTCACATGTCATGTCG
AGCCTGCTCAACTACGCCGTCTTTCACCCACTCAACGATTTCTACATGCAGAGAGGTTCGTCGCAGACACTCATC
AACACACACGATGCCGTCAGCTGGGCCTTTTCCGATCCGTCGGTGCTGGGGACATTCATAGACAATCACGATAAC
CCGAGATGGCTTAGCCAGAAGAACGACCACGCTCTGTTGAAGAACGCTCTTACCTACGTCCTTCTCGCCCGCGGC
ATCCCCATTGTCTATTATGCCACCGAGCAAGGATATGCCGGTGGCCATGACCCAGCGAATCGTGAGAGCCTCTGG
CATACCAACTTTGACACTAAAGGCGACCTGTATCGGTTCATCAGTCGGGTTTCCCGCGTACGAAAGGCCGCAGGG
GGGCTGCCGCAAAATGATCACGTCCACCTCATGGTTGAGGATACAGGCTACGCGTGGAGCCGTGCGGGTGGCGAC
GTGATTGCGCTGACGAGCAATATCGGAAGCGGAAACTCGAGGGAGTATTGTCTCTTTACGAGAAGGCCACATGGC
GTTTGGAAGGATGTGTTTGAGGGTAAAGGGTACACTGCTGATGAAAGAGGCTGGATGTGTGCCCATATCTACGGT
GGCAACCCAATTATTCTGGTTTCTGCTTGA
Gene >Ophio5|7346
ATGAAGCCCTCGACCTTGCTCTCATTCGTCATCCAGCTCTCCGTCCCTGCACTCGCAGCGGACGCGACAGCCTGG
AAGTCACGCAGCATCTACTTTGCCTTGACTGATCGAATCGCACGAAACACTACCGATGGCGATAGAAGCCCATGT
TACGAGCTGGGGAGGTACTGCGGAGGGACTTTTAGCGGCCTGGAGTCGAAGCTCGACTACATCAAAGATCTGGGC
TTTGACGCCATTTGGATCTCGCCCGTGATTAAAAGTCAGTATCTGTTACAGATGAGAGTGTCGTCCGTACGGACA
CATACACCTTGTATCGTTCTATGTTTCTCAGCTTGACTGACCATTCCATCGTGAGCCCTCAACGTAGACCATGAT
GGCGGCTATCACGGATACTGGGCCCAGGACTTGTACTCGATCAACCCCAATTTCGGAACAGCTGATGAGCTCAAA
AGCCTCGTCAATGCTGCACACAGCAAGGTATGATCTGCCGAGCACCTCGTCACGGGGTAATGCTGAAATCAGGTG
GTGAGAAAGGACATGTATGTCATGGTGGATGTTGTCGCCAATCACATGGGCGGGCCTATCTCTCAGAACAGACCT
GAGCCCTTGAATCAAGACTGGTCATACCACACGCCGTGCATGATCAACTACGGAGACCAAGGCAGCGTGGAATAC
TGCCAAATCGGCGGTCTGCCCGACCTCGACACTCGAAATCCGCAGATCCGCCAGTTGCTTTACAACTGGATTCAC
TGGCTTGTTGAGGAGTTCCGGTTCGATGGTCTTCGGATTGACACGGTAAAGCATGTCGAGAAAGACTTCTGGTCG
GGATTCTCGGCTGCCGCTGGCGTCTTCACCATCGGAGAGGCGTTTGATCACCGCGTCGACGTCCTAGCAGGTTAC
TCACATGTCATGTCGAGCCTGCTCAACTACGCCGTCTTTCACCCACTCAACGATTTCTACATGCAGAGAGGTTCG
TCGCAGACACTCATCAACACACACGATGCCGTCAGCTGGGCCTTTTCCGATCCGTCGGTGCTGGGGACATTCATA
GACAATCACGATAACCCGAGATGGCTTAGCCAGAAGAACGACCACGCTCTGTTGAAGAACGCTCTTACCTACGTC
CTTCTCGCCCGCGGCATCCCCATTGTCTATTATGCCACCGAGCAAGGATATGCCGGTGGCCATGACCCAGCGAAT
CGTGAGAGCCTCTGGCATACCAACTTTGACACTAAAGGCGACCTGTATCGGTTCATCAGTCGGGTTTCCCGCGTA
CGAAAGGCCGCAGGGGGGCTGCCGCAAAATGATCACGTCCACCTCATGGTTGAGGATACAGGCTACGCGTGGAGC
CGTGCGGGTGGCGACGTGATTGCGCTGACGAGCAATATCGGAAGCGGAAACTCGAGGGAGTATTGTCTCTTTACG
AGAAGGCCACATGGCGTTTGGAAGGATGTGTTTGAGGGTAAAGGGTACACTGCTGATGAAAGAGGCTGGATGTGT
GCCCATATCTACGGTGGCAACCCAATTATTCTGGTTTCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail