Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7337
Gene name
Locationscaffold_70:3177..4459
Strand+
Gene length (bp)1282
Transcript length (bp)1203
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 9.4E-22 80 230
PF14437 MafB19-deam MafB19-like deaminase 1.7E-06 82 138
PF14437 MafB19-deam MafB19-like deaminase 1.5E-07 197 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47058|TAD2_YEAST tRNA-specific adenosine deaminase subunit TAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAD2 PE=1 SV=1 80 400 3.0E-30
sp|Q7Z6V5|ADAT2_HUMAN tRNA-specific adenosine deaminase 2 OS=Homo sapiens GN=ADAT2 PE=1 SV=1 80 332 1.0E-28
sp|O94642|TAD2_SCHPO tRNA-specific adenosine deaminase subunit tad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tad2 PE=3 SV=2 78 335 5.0E-28
sp|Q6P6J0|ADAT2_MOUSE tRNA-specific adenosine deaminase 2 OS=Mus musculus GN=Adat2 PE=1 SV=1 80 324 7.0E-28
sp|Q5E9J7|ADAT2_BOVIN tRNA-specific adenosine deaminase 2 OS=Bos taurus GN=DEADC1 PE=2 SV=1 80 330 8.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47058|TAD2_YEAST tRNA-specific adenosine deaminase subunit TAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAD2 PE=1 SV=1 80 400 3.0E-30
sp|Q7Z6V5|ADAT2_HUMAN tRNA-specific adenosine deaminase 2 OS=Homo sapiens GN=ADAT2 PE=1 SV=1 80 332 1.0E-28
sp|O94642|TAD2_SCHPO tRNA-specific adenosine deaminase subunit tad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tad2 PE=3 SV=2 78 335 5.0E-28
sp|Q6P6J0|ADAT2_MOUSE tRNA-specific adenosine deaminase 2 OS=Mus musculus GN=Adat2 PE=1 SV=1 80 324 7.0E-28
sp|Q5E9J7|ADAT2_BOVIN tRNA-specific adenosine deaminase 2 OS=Bos taurus GN=DEADC1 PE=2 SV=1 80 330 8.0E-27
sp|Q5RIV4|ADAT2_DANRE tRNA-specific adenosine deaminase 2 OS=Danio rerio GN=adat2 PE=2 SV=2 83 327 4.0E-26
sp|Q0P4H0|ADAT2_XENTR tRNA-specific adenosine deaminase 2 OS=Xenopus tropicalis GN=adat2 PE=2 SV=1 83 330 2.0E-24
sp|Q4V7V8|ADAT2_XENLA tRNA-specific adenosine deaminase 2 OS=Xenopus laevis GN=adat2 PE=2 SV=1 83 330 3.0E-24
sp|P0DA21|TADA_STRPQ tRNA-specific adenosine deaminase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tadA PE=3 SV=1 80 245 1.0E-14
sp|Q5XE14|TADA_STRP6 tRNA-specific adenosine deaminase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tadA PE=1 SV=2 80 245 1.0E-14
sp|P0DA20|TADA_STRP3 tRNA-specific adenosine deaminase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tadA PE=3 SV=1 80 245 1.0E-14
sp|P68999|TADA_STRP1 tRNA-specific adenosine deaminase OS=Streptococcus pyogenes serotype M1 GN=tadA PE=3 SV=1 80 245 1.0E-14
sp|Q8P2R7|TADA_STRP8 tRNA-specific adenosine deaminase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=tadA PE=3 SV=1 80 245 1.0E-14
sp|Q9S7I0|TADA_ARATH tRNA(adenine(34)) deaminase, chloroplastic OS=Arabidopsis thaliana GN=TADA PE=1 SV=1 53 245 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0002100 tRNA wobble adenosine to inosine editing Yes
GO:0008251 tRNA-specific adenosine deaminase activity Yes
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0019239 deaminase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016787 hydrolase activity No
GO:0046483 heterocycle metabolic process No
GO:0008033 tRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0006400 tRNA modification No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No
GO:0034470 ncRNA processing No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0009451 RNA modification No
GO:0002097 tRNA wobble base modification No
GO:0016553 base conversion or substitution editing No
GO:0004000 adenosine deaminase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0003824 catalytic activity No
GO:0006382 adenosine to inosine editing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7337
MSDSSSIINSPPRQQLSQKKRKKKKGRSKQRMADAHLDKENVPPQAVGALTVALKEVSLRGNKPKLDEDDEETRA
AKERQQNQRFIDEALEMARLALRTNETPVGCVLVRNGSIIAKGMNATNVTRNGTRHAELMAISALLSVASSSGPR
TTSLRPPRPKDDDSCTLDSPDEGNEDGSKSHLYPYGQKFLPDKQVDARILRDSVLYVTVEPCVMCASLLRQLGIK
KVYFGAVNDKFGGTGGVFSIHANSLPVGADGQTAASHPLPRCQPSQLPDGSGTLGTSYPPGGGDGGNVEPGYEIE
GGWGRDEAVGLLRRFYVQENGRAPVPRKKEGRAARLAAMIERDTNTSAPSLGLEESLDREGDTTLVGGLDSLGFR
SDGSDDEIDVRDKDGYLQLVEDNCR
Coding >Ophio5|7337
ATGTCGGACAGCAGCAGCATCATCAACTCGCCGCCGCGGCAGCAGCTTAGCCAGAAGAAGAGGAAGAAGAAGAAG
GGGAGGTCGAAGCAGAGAATGGCCGACGCACACCTCGACAAGGAAAACGTTCCGCCGCAGGCCGTCGGTGCTCTC
ACCGTCGCTCTGAAGGAAGTCAGCCTGCGAGGCAACAAGCCGAAGCTTGACGAGGATGACGAGGAGACGCGTGCA
GCCAAAGAGCGGCAGCAGAATCAGCGCTTCATAGACGAGGCTCTGGAGATGGCACGGCTCGCTCTTAGAACAAAT
GAAACGCCCGTTGGATGCGTCCTCGTCCGCAACGGTTCCATCATCGCCAAGGGAATGAATGCGACAAACGTCACC
CGCAACGGAACTCGTCATGCCGAGCTCATGGCCATTTCAGCCTTGCTCTCCGTCGCATCGTCGTCTGGTCCGCGC
ACCACCTCTCTCAGGCCTCCGCGGCCCAAAGATGACGACAGCTGCACCCTCGACTCCCCGGATGAGGGCAACGAG
GACGGAAGCAAGAGTCATCTCTACCCCTACGGACAGAAGTTTCTTCCGGACAAGCAAGTCGATGCCCGGATTCTG
CGAGACAGCGTGCTCTACGTCACCGTCGAGCCCTGCGTCATGTGCGCATCGCTGCTGCGCCAACTGGGCATCAAA
AAGGTCTATTTCGGCGCCGTCAACGACAAGTTTGGTGGCACCGGTGGCGTCTTCAGCATACACGCCAACTCGTTG
CCCGTCGGCGCGGACGGCCAGACGGCCGCCTCGCATCCGTTGCCGCGCTGCCAGCCGTCGCAGCTTCCGGACGGA
AGCGGTACGCTCGGAACCTCTTACCCGCCCGGCGGCGGCGACGGAGGCAACGTCGAGCCGGGATACGAGATCGAG
GGCGGCTGGGGACGCGATGAGGCCGTTGGTTTGTTGCGTCGCTTCTACGTCCAGGAGAATGGGCGGGCGCCGGTG
CCGCGCAAGAAGGAGGGTCGTGCCGCGCGTCTGGCTGCCATGATTGAGAGGGATACCAACACGTCGGCGCCGTCG
CTGGGTCTTGAAGAGTCGCTGGATCGGGAGGGCGACACGACGCTGGTGGGCGGCCTCGATAGCCTGGGCTTCCGG
TCTGATGGCAGCGATGACGAGATTGATGTCCGCGACAAGGACGGTTATCTGCAGCTTGTCGAGGACAACTGTCGC
Transcript >Ophio5|7337
ATGTCGGACAGCAGCAGCATCATCAACTCGCCGCCGCGGCAGCAGCTTAGCCAGAAGAAGAGGAAGAAGAAGAAG
GGGAGGTCGAAGCAGAGAATGGCCGACGCACACCTCGACAAGGAAAACGTTCCGCCGCAGGCCGTCGGTGCTCTC
ACCGTCGCTCTGAAGGAAGTCAGCCTGCGAGGCAACAAGCCGAAGCTTGACGAGGATGACGAGGAGACGCGTGCA
GCCAAAGAGCGGCAGCAGAATCAGCGCTTCATAGACGAGGCTCTGGAGATGGCACGGCTCGCTCTTAGAACAAAT
GAAACGCCCGTTGGATGCGTCCTCGTCCGCAACGGTTCCATCATCGCCAAGGGAATGAATGCGACAAACGTCACC
CGCAACGGAACTCGTCATGCCGAGCTCATGGCCATTTCAGCCTTGCTCTCCGTCGCATCGTCGTCTGGTCCGCGC
ACCACCTCTCTCAGGCCTCCGCGGCCCAAAGATGACGACAGCTGCACCCTCGACTCCCCGGATGAGGGCAACGAG
GACGGAAGCAAGAGTCATCTCTACCCCTACGGACAGAAGTTTCTTCCGGACAAGCAAGTCGATGCCCGGATTCTG
CGAGACAGCGTGCTCTACGTCACCGTCGAGCCCTGCGTCATGTGCGCATCGCTGCTGCGCCAACTGGGCATCAAA
AAGGTCTATTTCGGCGCCGTCAACGACAAGTTTGGTGGCACCGGTGGCGTCTTCAGCATACACGCCAACTCGTTG
CCCGTCGGCGCGGACGGCCAGACGGCCGCCTCGCATCCGTTGCCGCGCTGCCAGCCGTCGCAGCTTCCGGACGGA
AGCGGTACGCTCGGAACCTCTTACCCGCCCGGCGGCGGCGACGGAGGCAACGTCGAGCCGGGATACGAGATCGAG
GGCGGCTGGGGACGCGATGAGGCCGTTGGTTTGTTGCGTCGCTTCTACGTCCAGGAGAATGGGCGGGCGCCGGTG
CCGCGCAAGAAGGAGGGTCGTGCCGCGCGTCTGGCTGCCATGATTGAGAGGGATACCAACACGTCGGCGCCGTCG
CTGGGTCTTGAAGAGTCGCTGGATCGGGAGGGCGACACGACGCTGGTGGGCGGCCTCGATAGCCTGGGCTTCCGG
TCTGATGGCAGCGATGACGAGATTGATGTCCGCGACAAGGACGGTTATCTGCAGCTTGTCGAGGACAACTGTCGC
TAG
Gene >Ophio5|7337
ATGTCGGACAGCAGCAGCATCATCAACTCGCCGCCGCGGCAGCAGCTTAGCCAGAAGAAGAGGAAGAAGAAGAAG
GGGAGGTCGAAGCAGAGAATGGCCGACGCACACCTCGACAAGGAAAACGTTCCGCCGCAGGCCGTCGGTGCTCTC
ACCGTCGCTCTGAAGGAAGTCAGCCTGCGAGGCAACAAGCCGAAGCTTGACGAGGATGACGAGGAGACGCGTGCA
GCCAAAGAGCGGCAGCAGAATCAGCGCTTCATAGACGAGGCTCTGGAGATGGTAGGCCAGACGAAAAGACCTTTT
CCCTCCTTCCCAACAGAGAAAAAAAAAAAAAGACTGACTCTCCCACCACCCAAAGGCACGGCTCGCTCTTAGAAC
AAATGAAACGCCCGTTGGATGCGTCCTCGTCCGCAACGGTTCCATCATCGCCAAGGGAATGAATGCGACAAACGT
CACCCGCAACGGAACTCGTCATGCCGAGCTCATGGCCATTTCAGCCTTGCTCTCCGTCGCATCGTCGTCTGGTCC
GCGCACCACCTCTCTCAGGCCTCCGCGGCCCAAAGATGACGACAGCTGCACCCTCGACTCCCCGGATGAGGGCAA
CGAGGACGGAAGCAAGAGTCATCTCTACCCCTACGGACAGAAGTTTCTTCCGGACAAGCAAGTCGATGCCCGGAT
TCTGCGAGACAGCGTGCTCTACGTCACCGTCGAGCCCTGCGTCATGTGCGCATCGCTGCTGCGCCAACTGGGCAT
CAAAAAGGTCTATTTCGGCGCCGTCAACGACAAGTTTGGTGGCACCGGTGGCGTCTTCAGCATACACGCCAACTC
GTTGCCCGTCGGCGCGGACGGCCAGACGGCCGCCTCGCATCCGTTGCCGCGCTGCCAGCCGTCGCAGCTTCCGGA
CGGAAGCGGTACGCTCGGAACCTCTTACCCGCCCGGCGGCGGCGACGGAGGCAACGTCGAGCCGGGATACGAGAT
CGAGGGCGGCTGGGGACGCGATGAGGCCGTTGGTTTGTTGCGTCGCTTCTACGTCCAGGAGAATGGGCGGGCGCC
GGTGCCGCGCAAGAAGGAGGGTCGTGCCGCGCGTCTGGCTGCCATGATTGAGAGGGATACCAACACGTCGGCGCC
GTCGCTGGGTCTTGAAGAGTCGCTGGATCGGGAGGGCGACACGACGCTGGTGGGCGGCCTCGATAGCCTGGGCTT
CCGGTCTGATGGCAGCGATGACGAGATTGATGTCCGCGACAAGGACGGTTATCTGCAGCTTGTCGAGGACAACTG
TCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail