Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7335
Gene name
Locationscaffold_70:231..1198
Strand+
Gene length (bp)967
Transcript length (bp)801
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01753 zf-MYND MYND finger 4.0E-11 40 80

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D3ZKV9|MSS51_RAT Putative protein MSS51 homolog, mitochondrial OS=Rattus norvegicus GN=Mss51 PE=3 SV=1 10 84 1.0E-06
sp|Q4VC12|MSS51_HUMAN Putative protein MSS51 homolog, mitochondrial OS=Homo sapiens GN=MSS51 PE=1 SV=2 40 84 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7335
MPVFLGVLRLPRFEGVTQRKLDGTKERIFRTKLIIMAPECIHCKKSPPEVKLRNCAKCSSALYCSRDCQKADWKA
HKKICGKNRDGPTTTTKGLETVIDNPFTRLENRTWLHDRSEKDVYGLLIDAYRLRVEDMYSFEGEADMDSIYGGA
PNGLRGFRRFLQRVEKSSGLMPPWWDADKKKECEALGMSSSQWHDLQCAVEKSDIVDHYGNPQFPMQLRMFAELV
YGRAPGGTSGTAMRQLLMAMENGTNGGTYSHLDVSAGPGRQ
Coding >Ophio5|7335
ATGCCGGTCTTCCTAGGCGTTCTTCGGCTGCCCAGGTTCGAAGGAGTAACCCAGAGGAAGCTAGACGGCACGAAA
GAAAGGATTTTTCGGACGAAATTGATCATCATGGCCCCGGAATGCATTCACTGCAAGAAGTCGCCGCCTGAAGTC
AAGCTCAGGAATTGCGCGAAATGTTCCTCGGCGCTCTACTGCTCCCGGGATTGCCAGAAGGCAGACTGGAAGGCT
CATAAGAAAATTTGCGGCAAAAATCGAGATGGGCCGACAACGACAACAAAGGGATTGGAAACTGTCATCGATAAC
CCCTTTACGCGTCTCGAGAATCGCACTTGGCTCCATGATCGATCGGAAAAAGACGTCTACGGCTTGCTGATCGAC
GCCTACCGACTTCGAGTCGAAGACATGTACAGCTTCGAAGGCGAGGCAGACATGGATAGCATCTATGGTGGTGCG
CCAAACGGGTTGCGTGGCTTCCGGCGCTTCCTGCAGCGCGTCGAGAAATCCTCCGGCCTAATGCCGCCGTGGTGG
GATGCCGACAAGAAGAAAGAGTGTGAGGCACTGGGTATGAGTTCATCGCAATGGCATGACCTGCAATGCGCAGTG
GAAAAGAGCGACATCGTGGACCATTATGGAAATCCTCAATTCCCGATGCAGCTTCGCATGTTTGCCGAGCTCGTC
TATGGTCGAGCTCCGGGCGGGACGAGTGGAACGGCGATGAGGCAACTTCTGATGGCCATGGAGAACGGCACGAAC
GGGGGAACGTATTCGCATCTGGACGTGTCAGCCGGCCCTGGTCGGCAG
Transcript >Ophio5|7335
ATGCCGGTCTTCCTAGGCGTTCTTCGGCTGCCCAGGTTCGAAGGAGTAACCCAGAGGAAGCTAGACGGCACGAAA
GAAAGGATTTTTCGGACGAAATTGATCATCATGGCCCCGGAATGCATTCACTGCAAGAAGTCGCCGCCTGAAGTC
AAGCTCAGGAATTGCGCGAAATGTTCCTCGGCGCTCTACTGCTCCCGGGATTGCCAGAAGGCAGACTGGAAGGCT
CATAAGAAAATTTGCGGCAAAAATCGAGATGGGCCGACAACGACAACAAAGGGATTGGAAACTGTCATCGATAAC
CCCTTTACGCGTCTCGAGAATCGCACTTGGCTCCATGATCGATCGGAAAAAGACGTCTACGGCTTGCTGATCGAC
GCCTACCGACTTCGAGTCGAAGACATGTACAGCTTCGAAGGCGAGGCAGACATGGATAGCATCTATGGTGGTGCG
CCAAACGGGTTGCGTGGCTTCCGGCGCTTCCTGCAGCGCGTCGAGAAATCCTCCGGCCTAATGCCGCCGTGGTGG
GATGCCGACAAGAAGAAAGAGTGTGAGGCACTGGGTATGAGTTCATCGCAATGGCATGACCTGCAATGCGCAGTG
GAAAAGAGCGACATCGTGGACCATTATGGAAATCCTCAATTCCCGATGCAGCTTCGCATGTTTGCCGAGCTCGTC
TATGGTCGAGCTCCGGGCGGGACGAGTGGAACGGCGATGAGGCAACTTCTGATGGCCATGGAGAACGGCACGAAC
GGGGGAACGTATTCGCATCTGGACGTGTCAGCCGGCCCTGGTCGGCAGTGA
Gene >Ophio5|7335
ATGCCGGTCTTCCTAGGCGTTCTTCGGCTGCCCAGGTTCTTTAAACCTCATGGCTGCCTAGGTATATAAGCCCGC
CTAGATAGATTATAACCACCTTCAATTATCACCTGCCCGTATCCGCTGTCTAGCACATCCTATCTAGGTTCGAAG
GAGTAACGTAAGCACCCCAAGCTGCAAGGTGTCACGCCGCACTAACCACACTCTTTTCCCTTTTAGCCAGAGGAA
GCTAGACGGCACGAAAGAAAGGATTTTTCGGACGAAATTGATCATCATGGCCCCGGAATGCATTCACTGCAAGAA
GTCGCCGCCTGAAGTCAAGCTCAGGAATTGCGCGAAATGTTCCTCGGCGCTCTACTGCTCCCGGGATTGCCAGAA
GGCAGACTGGAAGGCTCATAAGAAAATTTGCGGCAAAAATCGAGATGGGCCGACAACGACAACAAAGGGATTGGA
AACTGTCATCGATAACCCCTTTACGCGTCTCGAGAATCGCACTTGGCTCCATGATCGATCGGAAAAAGACGTCTA
CGGCTTGCTGATCGACGCCTACCGACTTCGAGTCGAAGACATGTACAGCTTCGAAGGCGAGGCAGACATGGATAG
CATCTATGGTGGTGCGCCAAACGGGTTGCGTGGCTTCCGGCGCTTCCTGCAGCGCGTCGAGAAATCCTCCGGCCT
AATGCCGCCGTGGTGGGATGCCGACAAGAAGAAAGAGTGTGAGGCACTGGGTATGAGTTCATCGCAATGGCATGA
CCTGCAATGCGCAGTGGAAAAGAGCGACATCGTGGACCATTATGGAAATCCTCAATTCCCGATGCAGCTTCGCAT
GTTTGCCGAGCTCGTCTATGGTCGAGCTCCGGGCGGGACGAGTGGAACGGCGATGAGGCAACTTCTGATGGCCAT
GGAGAACGGCACGAACGGGGGAACGTATTCGCATCTGGACGTGTCAGCCGGCCCTGGTCGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail