Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|732
Gene name
Locationscaffold_12:61397..64589
Strand+
Gene length (bp)3192
Transcript length (bp)3192
Coding sequence length (bp)3189
Protein length (aa) 1063

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.7E-09 598 665
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.6E-10 675 740
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.3E-16 767 832
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-04 896 956
PF16842 RRM_occluded Occluded RNA-recognition motif 6.3E-27 889 965
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-01 579 672
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.0E-04 760 846

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 591 1043 7.0E-57
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 591 1044 1.0E-30
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 4 862 1.0E-27
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 583 836 8.0E-16
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 595 836 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 591 1043 7.0E-57
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 591 1044 1.0E-30
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 4 862 1.0E-27
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 583 836 8.0E-16
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 595 836 1.0E-14
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 571 836 1.0E-14
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 596 955 2.0E-14
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 575 836 3.0E-14
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 576 836 7.0E-14
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 576 836 7.0E-14
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 4 759 9.0E-14
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 674 836 1.0E-13
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 596 840 2.0E-13
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 672 836 2.0E-13
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 669 860 2.0E-13
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 576 836 3.0E-13
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 595 836 4.0E-13
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 669 872 5.0E-13
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 596 947 7.0E-13
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 674 836 9.0E-13
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 2 340 1.0E-12
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 597 850 1.0E-12
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 590 836 2.0E-12
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 574 836 2.0E-12
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 597 850 2.0E-12
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 597 850 3.0E-12
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 597 850 3.0E-12
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 674 836 3.0E-12
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 597 850 4.0E-12
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 597 850 5.0E-12
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 596 876 7.0E-12
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 596 947 8.0E-12
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 674 836 1.0E-11
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 596 1009 3.0E-11
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 597 850 4.0E-11
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 583 847 5.0E-11
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 596 947 5.0E-11
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 596 947 5.0E-11
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 597 850 5.0E-11
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 674 836 7.0E-11
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 597 850 8.0E-11
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 587 841 1.0E-10
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 672 836 1.0E-10
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 675 839 2.0E-10
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 596 947 2.0E-10
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 596 947 2.0E-10
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 596 947 2.0E-10
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 597 850 2.0E-10
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 663 1002 2.0E-10
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 591 847 2.0E-10
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 596 836 3.0E-10
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 558 836 3.0E-10
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 596 947 6.0E-10
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 596 847 6.0E-10
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 572 836 6.0E-10
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 591 845 8.0E-10
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 596 846 9.0E-10
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 596 974 1.0E-09
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 641 839 1.0E-09
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 597 850 1.0E-09
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 662 847 1.0E-09
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 596 974 2.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 662 847 2.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 597 848 2.0E-09
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 765 883 2.0E-09
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 596 974 5.0E-09
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 589 847 6.0E-09
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 596 947 6.0E-09
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 597 850 6.0E-09
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 596 850 6.0E-09
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 596 851 7.0E-09
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 639 1003 1.0E-08
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 765 883 2.0E-08
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 765 883 2.0E-08
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 765 883 2.0E-08
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 765 883 2.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 582 947 2.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 582 947 2.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 582 947 2.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 582 947 2.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 582 947 2.0E-08
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 589 848 2.0E-08
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 589 848 2.0E-08
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 595 955 2.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 582 947 2.0E-08
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 689 811 3.0E-08
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 674 842 4.0E-08
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 765 883 5.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 583 840 7.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 663 847 8.0E-08
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 596 860 9.0E-08
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 596 851 1.0E-07
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 757 843 1.0E-07
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 746 844 2.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 674 861 3.0E-07
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 768 842 4.0E-07
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 744 837 4.0E-07
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 596 840 5.0E-07
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 596 840 5.0E-07
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 596 840 5.0E-07
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 596 840 5.0E-07
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 596 840 5.0E-07
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 596 840 5.0E-07
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 572 840 5.0E-07
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 768 842 5.0E-07
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 673 827 5.0E-07
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 598 840 6.0E-07
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 669 956 6.0E-07
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 572 840 6.0E-07
sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 598 825 7.0E-07
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 641 838 7.0E-07
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 641 838 7.0E-07
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 641 838 7.0E-07
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 588 739 7.0E-07
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 674 956 7.0E-07
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 596 847 8.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 662 847 8.0E-07
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 677 841 1.0E-06
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 553 722 1.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 674 836 2.0E-06
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 588 824 2.0E-06
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 588 824 2.0E-06
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 588 824 2.0E-06
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 766 841 2.0E-06
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 641 838 2.0E-06
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 677 841 2.0E-06
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 670 836 2.0E-06
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 731 837 2.0E-06
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 674 828 2.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 590 824 3.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 761 957 3.0E-06
sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 598 840 3.0E-06
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 670 956 3.0E-06
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 744 837 3.0E-06
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 587 722 3.0E-06
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 671 861 3.0E-06
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 673 837 4.0E-06
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 674 828 4.0E-06
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 744 837 4.0E-06
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 596 847 5.0E-06
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 737 837 5.0E-06
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 744 837 5.0E-06
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 744 837 5.0E-06
sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 744 837 6.0E-06
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 744 837 6.0E-06
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 744 837 6.0E-06
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 744 837 6.0E-06
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 744 837 6.0E-06
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 744 837 7.0E-06
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 674 873 7.0E-06
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 734 837 7.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 662 847 8.0E-06
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 641 838 8.0E-06
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 582 836 8.0E-06
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 761 957 8.0E-06
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 744 837 9.0E-06
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 582 836 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2021 0.9003 0.079 0.0093 0.0337 0.0083 0.0341 0.0101 0.0353 0.004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6356
Ophiocordyceps australis map64 (Brazil) OphauB2|101
Ophiocordyceps camponoti-floridani Ophcf2|00899
Ophiocordyceps camponoti-rufipedis Ophun1|7533
Ophiocordyceps kimflemingae Ophio5|732 (this protein)
Ophiocordyceps subramaniannii Hirsu2|51

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|732
MVNPVGEESWLAYLEEAARNASDVEQCVNVVELYKRATGAEPASLRIWLAYCQYFWGLWVGSQVNDGAWPENEQM
IARELFTFGTALDLWQQGYEAIKYRLDDSHLLWDRWLSLEMEQLAKTKTPEGVRRVTHLYCDRLGTPHLTWDETS
QAFSTFLSEYNTAAWEETMKKTTALAQGAKQAVAARDSFELKLKEASRHGQVDTLKSVMRDYLEWEMRHSQGDAG
ASKFASDLCCGLFERALSGVLALDDGVWQEYIVYVSSQSESQAPERLLDILRRAVQHCPWSGQLWNRYILCAEEA
KRSFSDIESIKHAATSENQLYKNGMESMIEMYVAWCGFLKRTAIEATATDEAVDLADVGLRAALEDVAVVGKRLY
GKEFQGDPKFRLERIYIQYLTEKKGAIDEARIVWNKLADVRIHADSYDFWIRYYMWEMFIFSSNSQPVRSPTPSS
GVNSCLRVPKLGTAVLHAAANRETIDWPERVLEVYLQHCNDYELPSAVRRATDMVHKLDKTVRRRRRREEEEKAA
AFAAYYGTASAEVVDDSATVNGSKRKRDPPLEPTEDGGDKGNKRQRTSGEVATAQPMSSAEPNAKRDRENATVIV
TGLPAEVTQTKVRQYFKEYGHINSLTAIVREKDGQSSTALIEFSSPEEAQSALLRDGKYFGQSQLSVLSGHDLTV
YVANFPPVADDEYIRNLFKDCGEILSIRWPSLKVNAHRRFCYVSFRDRASSAKAVAKEGTLLNGKFSLLAKYSDP
SRRKKREGAVAEGRELHVTGLDRATTEDEIRDIFSKLGMVSRVTMPLNMAGKNRGFAFVAMETKEEAESAAEEMN
KTKLRSQILQVEVSKESKVKHAAKTMVGASPASPSEPGGGDQHAERGSASGGDGSAPSAADIEARTVALMGLPDT
VNDTRIRALVEPLGAIVQLVVQPGHGGAKIEFADASTAGKAALQLDGLDFDGNKLRTGSVGDLRRAKADRTDDRI
VYGGSKDKKSAAGPSETQKRGLMPPPAQIRRAGPKRGVGFPPRHREAKAAENGKAAPKSNADFRAMLLGAGGKEA
EEPEEVVKGESDA
Coding >Ophio5|732
ATGGTCAACCCAGTAGGTGAGGAGAGCTGGCTCGCCTATCTCGAAGAGGCGGCCCGCAACGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTTTACAAGCGCGCCACCGGCGCCGAGCCCGCCAGCCTTCGTATCTGGCTGGCC
TACTGCCAATACTTCTGGGGCCTCTGGGTCGGCAGCCAGGTAAACGACGGCGCCTGGCCCGAAAACGAGCAGATG
ATAGCCCGCGAGCTCTTCACCTTTGGCACCGCCCTCGACCTGTGGCAGCAGGGCTACGAGGCCATCAAGTACCGC
CTCGACGATAGCCACCTGCTATGGGACCGCTGGCTCTCTCTCGAAATGGAGCAGCTGGCCAAGACCAAGACCCCC
GAGGGCGTCCGGCGCGTAACCCACCTCTACTGCGACCGTCTCGGTACCCCCCATCTTACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTCTGTCCGAGTACAACACGGCCGCGTGGGAGGAGACGATGAAGAAGACCACGGCACTT
GCTCAAGGAGCCAAGCAGGCCGTTGCCGCCCGCGACTCCTTTGAGCTGAAGCTCAAGGAGGCTTCACGCCATGGT
CAGGTCGATACCCTCAAGTCCGTTATGAGAGACTACTTGGAATGGGAAATGCGCCATAGTCAGGGCGATGCCGGC
GCCTCGAAATTCGCGTCCGATCTTTGCTGCGGTCTCTTCGAGAGGGCTCTCAGTGGTGTACTCGCCTTGGACGAC
GGCGTCTGGCAAGAGTACATCGTCTACGTCTCCTCTCAAAGCGAGTCGCAGGCGCCCGAGAGGCTGCTCGACATA
TTACGCCGGGCCGTCCAGCATTGTCCCTGGTCAGGCCAGCTTTGGAACCGGTACATTCTGTGCGCCGAGGAGGCT
AAGCGCTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCTACGAGTGAGAACCAACTATACAAGAACGGCATG
GAGAGCATGATCGAGATGTATGTCGCCTGGTGCGGCTTCCTGAAGCGCACCGCCATTGAGGCTACCGCCACCGAC
GAGGCTGTCGACCTGGCCGACGTGGGCCTCAGAGCCGCTCTCGAGGACGTGGCAGTTGTCGGCAAGAGGCTCTAT
GGCAAGGAGTTTCAGGGCGATCCAAAGTTTCGGCTCGAGAGAATCTACATACAGTATCTGACCGAGAAGAAGGGA
GCCATCGATGAGGCCAGGATCGTGTGGAACAAGCTGGCCGACGTCCGGATCCACGCCGACAGTTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCATCTTCTCGTCCAACTCCCAGCCCGTCAGAAGCCCTACGCCTTCGTCG
GGTGTCAACTCCTGTCTGCGGGTCCCCAAGCTCGGTACCGCTGTCCTGCATGCCGCTGCCAACCGGGAAACCATT
GACTGGCCCGAGAGGGTCCTGGAGGTCTACCTGCAACATTGCAACGACTACGAGCTCCCGTCGGCGGTGCGGCGC
GCAACCGACATGGTACACAAGCTAGACAAGACAGTCCGGAGGCGGCGACGGCGCGAAGAAGAAGAAAAGGCTGCC
GCCTTCGCCGCTTACTATGGCACGGCCTCGGCTGAGGTGGTGGACGATTCGGCTACGGTCAACGGGTCGAAGCGC
AAGCGTGACCCCCCCCTGGAGCCCACGGAGGATGGCGGCGATAAGGGCAATAAGCGACAGCGAACGAGCGGGGAG
GTGGCCACAGCCCAGCCGATGAGCTCGGCCGAGCCCAACGCCAAGAGGGATCGGGAAAACGCAACCGTCATCGTG
ACGGGTCTACCGGCCGAGGTCACACAGACCAAGGTTCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTC
ACGGCTATCGTTCGTGAGAAGGACGGCCAGTCGTCGACGGCCTTGATCGAATTCTCCAGTCCCGAGGAGGCCCAG
TCTGCGCTGCTGAGGGATGGCAAATATTTCGGCCAGTCGCAGCTGAGTGTTCTGTCGGGACACGACCTGACGGTG
TACGTGGCCAACTTTCCACCCGTGGCTGACGACGAGTACATACGGAATCTGTTCAAGGACTGCGGCGAGATACTG
AGCATCCGTTGGCCGAGCCTGAAGGTCAATGCCCACCGCCGCTTCTGCTACGTCTCCTTCCGCGATCGCGCGTCC
TCGGCCAAGGCCGTCGCCAAGGAGGGCACCCTCCTCAATGGCAAGTTTAGCCTGCTGGCCAAGTACTCGGATCCG
TCGCGCAGGAAGAAGCGCGAGGGCGCCGTCGCGGAAGGGCGCGAGCTTCACGTCACCGGGCTGGACAGGGCGACG
ACCGAGGACGAGATACGTGACATTTTCTCCAAACTGGGCATGGTGAGTAGGGTCACTATGCCGCTCAACATGGCC
GGCAAGAATCGCGGTTTCGCCTTTGTGGCCATGGAGACCAAGGAGGAGGCGGAGAGTGCGGCCGAGGAGATGAAC
AAAACGAAGCTGCGCAGCCAGATCCTCCAGGTCGAGGTCTCCAAGGAGTCCAAGGTGAAGCACGCGGCCAAGACG
ATGGTTGGGGCCTCGCCCGCCTCTCCATCGGAGCCCGGCGGCGGCGACCAACATGCCGAACGGGGCTCGGCGAGC
GGAGGCGATGGCTCGGCCCCGTCAGCGGCGGACATTGAGGCCCGGACCGTGGCCCTGATGGGCTTGCCAGACACG
GTCAACGACACGCGCATCCGGGCCCTCGTCGAGCCCCTCGGCGCCATCGTCCAGCTCGTCGTCCAGCCCGGTCAC
GGCGGGGCCAAGATCGAATTCGCCGATGCCTCCACCGCCGGAAAAGCGGCCCTCCAGCTCGACGGCCTCGATTTT
GACGGCAACAAGCTACGCACCGGCTCCGTCGGGGACCTCCGCCGCGCCAAAGCCGACCGGACCGACGACCGTATC
GTCTACGGCGGCAGCAAAGACAAGAAGAGCGCGGCGGGGCCCAGCGAGACGCAAAAGCGCGGCCTCATGCCGCCC
CCCGCGCAGATCCGTCGCGCCGGTCCCAAACGCGGCGTGGGATTCCCGCCCCGGCATCGCGAGGCGAAAGCCGCA
GAGAATGGGAAGGCCGCGCCAAAATCGAATGCCGACTTTAGGGCCATGCTCCTGGGCGCTGGCGGAAAAGAGGCT
GAGGAGCCGGAGGAGGTGGTCAAGGGCGAGAGCGACGCT
Transcript >Ophio5|732
ATGGTCAACCCAGTAGGTGAGGAGAGCTGGCTCGCCTATCTCGAAGAGGCGGCCCGCAACGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTTTACAAGCGCGCCACCGGCGCCGAGCCCGCCAGCCTTCGTATCTGGCTGGCC
TACTGCCAATACTTCTGGGGCCTCTGGGTCGGCAGCCAGGTAAACGACGGCGCCTGGCCCGAAAACGAGCAGATG
ATAGCCCGCGAGCTCTTCACCTTTGGCACCGCCCTCGACCTGTGGCAGCAGGGCTACGAGGCCATCAAGTACCGC
CTCGACGATAGCCACCTGCTATGGGACCGCTGGCTCTCTCTCGAAATGGAGCAGCTGGCCAAGACCAAGACCCCC
GAGGGCGTCCGGCGCGTAACCCACCTCTACTGCGACCGTCTCGGTACCCCCCATCTTACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTCTGTCCGAGTACAACACGGCCGCGTGGGAGGAGACGATGAAGAAGACCACGGCACTT
GCTCAAGGAGCCAAGCAGGCCGTTGCCGCCCGCGACTCCTTTGAGCTGAAGCTCAAGGAGGCTTCACGCCATGGT
CAGGTCGATACCCTCAAGTCCGTTATGAGAGACTACTTGGAATGGGAAATGCGCCATAGTCAGGGCGATGCCGGC
GCCTCGAAATTCGCGTCCGATCTTTGCTGCGGTCTCTTCGAGAGGGCTCTCAGTGGTGTACTCGCCTTGGACGAC
GGCGTCTGGCAAGAGTACATCGTCTACGTCTCCTCTCAAAGCGAGTCGCAGGCGCCCGAGAGGCTGCTCGACATA
TTACGCCGGGCCGTCCAGCATTGTCCCTGGTCAGGCCAGCTTTGGAACCGGTACATTCTGTGCGCCGAGGAGGCT
AAGCGCTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCTACGAGTGAGAACCAACTATACAAGAACGGCATG
GAGAGCATGATCGAGATGTATGTCGCCTGGTGCGGCTTCCTGAAGCGCACCGCCATTGAGGCTACCGCCACCGAC
GAGGCTGTCGACCTGGCCGACGTGGGCCTCAGAGCCGCTCTCGAGGACGTGGCAGTTGTCGGCAAGAGGCTCTAT
GGCAAGGAGTTTCAGGGCGATCCAAAGTTTCGGCTCGAGAGAATCTACATACAGTATCTGACCGAGAAGAAGGGA
GCCATCGATGAGGCCAGGATCGTGTGGAACAAGCTGGCCGACGTCCGGATCCACGCCGACAGTTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCATCTTCTCGTCCAACTCCCAGCCCGTCAGAAGCCCTACGCCTTCGTCG
GGTGTCAACTCCTGTCTGCGGGTCCCCAAGCTCGGTACCGCTGTCCTGCATGCCGCTGCCAACCGGGAAACCATT
GACTGGCCCGAGAGGGTCCTGGAGGTCTACCTGCAACATTGCAACGACTACGAGCTCCCGTCGGCGGTGCGGCGC
GCAACCGACATGGTACACAAGCTAGACAAGACAGTCCGGAGGCGGCGACGGCGCGAAGAAGAAGAAAAGGCTGCC
GCCTTCGCCGCTTACTATGGCACGGCCTCGGCTGAGGTGGTGGACGATTCGGCTACGGTCAACGGGTCGAAGCGC
AAGCGTGACCCCCCCCTGGAGCCCACGGAGGATGGCGGCGATAAGGGCAATAAGCGACAGCGAACGAGCGGGGAG
GTGGCCACAGCCCAGCCGATGAGCTCGGCCGAGCCCAACGCCAAGAGGGATCGGGAAAACGCAACCGTCATCGTG
ACGGGTCTACCGGCCGAGGTCACACAGACCAAGGTTCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTC
ACGGCTATCGTTCGTGAGAAGGACGGCCAGTCGTCGACGGCCTTGATCGAATTCTCCAGTCCCGAGGAGGCCCAG
TCTGCGCTGCTGAGGGATGGCAAATATTTCGGCCAGTCGCAGCTGAGTGTTCTGTCGGGACACGACCTGACGGTG
TACGTGGCCAACTTTCCACCCGTGGCTGACGACGAGTACATACGGAATCTGTTCAAGGACTGCGGCGAGATACTG
AGCATCCGTTGGCCGAGCCTGAAGGTCAATGCCCACCGCCGCTTCTGCTACGTCTCCTTCCGCGATCGCGCGTCC
TCGGCCAAGGCCGTCGCCAAGGAGGGCACCCTCCTCAATGGCAAGTTTAGCCTGCTGGCCAAGTACTCGGATCCG
TCGCGCAGGAAGAAGCGCGAGGGCGCCGTCGCGGAAGGGCGCGAGCTTCACGTCACCGGGCTGGACAGGGCGACG
ACCGAGGACGAGATACGTGACATTTTCTCCAAACTGGGCATGGTGAGTAGGGTCACTATGCCGCTCAACATGGCC
GGCAAGAATCGCGGTTTCGCCTTTGTGGCCATGGAGACCAAGGAGGAGGCGGAGAGTGCGGCCGAGGAGATGAAC
AAAACGAAGCTGCGCAGCCAGATCCTCCAGGTCGAGGTCTCCAAGGAGTCCAAGGTGAAGCACGCGGCCAAGACG
ATGGTTGGGGCCTCGCCCGCCTCTCCATCGGAGCCCGGCGGCGGCGACCAACATGCCGAACGGGGCTCGGCGAGC
GGAGGCGATGGCTCGGCCCCGTCAGCGGCGGACATTGAGGCCCGGACCGTGGCCCTGATGGGCTTGCCAGACACG
GTCAACGACACGCGCATCCGGGCCCTCGTCGAGCCCCTCGGCGCCATCGTCCAGCTCGTCGTCCAGCCCGGTCAC
GGCGGGGCCAAGATCGAATTCGCCGATGCCTCCACCGCCGGAAAAGCGGCCCTCCAGCTCGACGGCCTCGATTTT
GACGGCAACAAGCTACGCACCGGCTCCGTCGGGGACCTCCGCCGCGCCAAAGCCGACCGGACCGACGACCGTATC
GTCTACGGCGGCAGCAAAGACAAGAAGAGCGCGGCGGGGCCCAGCGAGACGCAAAAGCGCGGCCTCATGCCGCCC
CCCGCGCAGATCCGTCGCGCCGGTCCCAAACGCGGCGTGGGATTCCCGCCCCGGCATCGCGAGGCGAAAGCCGCA
GAGAATGGGAAGGCCGCGCCAAAATCGAATGCCGACTTTAGGGCCATGCTCCTGGGCGCTGGCGGAAAAGAGGCT
GAGGAGCCGGAGGAGGTGGTCAAGGGCGAGAGCGACGCTTGA
Gene >Ophio5|732
ATGGTCAACCCAGTAGGTGAGGAGAGCTGGCTCGCCTATCTCGAAGAGGCGGCCCGCAACGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTTTACAAGCGCGCCACCGGCGCCGAGCCCGCCAGCCTTCGTATCTGGCTGGCC
TACTGCCAATACTTCTGGGGCCTCTGGGTCGGCAGCCAGGTAAACGACGGCGCCTGGCCCGAAAACGAGCAGATG
ATAGCCCGCGAGCTCTTCACCTTTGGCACCGCCCTCGACCTGTGGCAGCAGGGCTACGAGGCCATCAAGTACCGC
CTCGACGATAGCCACCTGCTATGGGACCGCTGGCTCTCTCTCGAAATGGAGCAGCTGGCCAAGACCAAGACCCCC
GAGGGCGTCCGGCGCGTAACCCACCTCTACTGCGACCGTCTCGGTACCCCCCATCTTACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTCTGTCCGAGTACAACACGGCCGCGTGGGAGGAGACGATGAAGAAGACCACGGCACTT
GCTCAAGGAGCCAAGCAGGCCGTTGCCGCCCGCGACTCCTTTGAGCTGAAGCTCAAGGAGGCTTCACGCCATGGT
CAGGTCGATACCCTCAAGTCCGTTATGAGAGACTACTTGGAATGGGAAATGCGCCATAGTCAGGGCGATGCCGGC
GCCTCGAAATTCGCGTCCGATCTTTGCTGCGGTCTCTTCGAGAGGGCTCTCAGTGGTGTACTCGCCTTGGACGAC
GGCGTCTGGCAAGAGTACATCGTCTACGTCTCCTCTCAAAGCGAGTCGCAGGCGCCCGAGAGGCTGCTCGACATA
TTACGCCGGGCCGTCCAGCATTGTCCCTGGTCAGGCCAGCTTTGGAACCGGTACATTCTGTGCGCCGAGGAGGCT
AAGCGCTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCTACGAGTGAGAACCAACTATACAAGAACGGCATG
GAGAGCATGATCGAGATGTATGTCGCCTGGTGCGGCTTCCTGAAGCGCACCGCCATTGAGGCTACCGCCACCGAC
GAGGCTGTCGACCTGGCCGACGTGGGCCTCAGAGCCGCTCTCGAGGACGTGGCAGTTGTCGGCAAGAGGCTCTAT
GGCAAGGAGTTTCAGGGCGATCCAAAGTTTCGGCTCGAGAGAATCTACATACAGTATCTGACCGAGAAGAAGGGA
GCCATCGATGAGGCCAGGATCGTGTGGAACAAGCTGGCCGACGTCCGGATCCACGCCGACAGTTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCATCTTCTCGTCCAACTCCCAGCCCGTCAGAAGCCCTACGCCTTCGTCG
GGTGTCAACTCCTGTCTGCGGGTCCCCAAGCTCGGTACCGCTGTCCTGCATGCCGCTGCCAACCGGGAAACCATT
GACTGGCCCGAGAGGGTCCTGGAGGTCTACCTGCAACATTGCAACGACTACGAGCTCCCGTCGGCGGTGCGGCGC
GCAACCGACATGGTACACAAGCTAGACAAGACAGTCCGGAGGCGGCGACGGCGCGAAGAAGAAGAAAAGGCTGCC
GCCTTCGCCGCTTACTATGGCACGGCCTCGGCTGAGGTGGTGGACGATTCGGCTACGGTCAACGGGTCGAAGCGC
AAGCGTGACCCCCCCCTGGAGCCCACGGAGGATGGCGGCGATAAGGGCAATAAGCGACAGCGAACGAGCGGGGAG
GTGGCCACAGCCCAGCCGATGAGCTCGGCCGAGCCCAACGCCAAGAGGGATCGGGAAAACGCAACCGTCATCGTG
ACGGGTCTACCGGCCGAGGTCACACAGACCAAGGTTCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTC
ACGGCTATCGTTCGTGAGAAGGACGGCCAGTCGTCGACGGCCTTGATCGAATTCTCCAGTCCCGAGGAGGCCCAG
TCTGCGCTGCTGAGGGATGGCAAATATTTCGGCCAGTCGCAGCTGAGTGTTCTGTCGGGACACGACCTGACGGTG
TACGTGGCCAACTTTCCACCCGTGGCTGACGACGAGTACATACGGAATCTGTTCAAGGACTGCGGCGAGATACTG
AGCATCCGTTGGCCGAGCCTGAAGGTCAATGCCCACCGCCGCTTCTGCTACGTCTCCTTCCGCGATCGCGCGTCC
TCGGCCAAGGCCGTCGCCAAGGAGGGCACCCTCCTCAATGGCAAGTTTAGCCTGCTGGCCAAGTACTCGGATCCG
TCGCGCAGGAAGAAGCGCGAGGGCGCCGTCGCGGAAGGGCGCGAGCTTCACGTCACCGGGCTGGACAGGGCGACG
ACCGAGGACGAGATACGTGACATTTTCTCCAAACTGGGCATGGTGAGTAGGGTCACTATGCCGCTCAACATGGCC
GGCAAGAATCGCGGTTTCGCCTTTGTGGCCATGGAGACCAAGGAGGAGGCGGAGAGTGCGGCCGAGGAGATGAAC
AAAACGAAGCTGCGCAGCCAGATCCTCCAGGTCGAGGTCTCCAAGGAGTCCAAGGTGAAGCACGCGGCCAAGACG
ATGGTTGGGGCCTCGCCCGCCTCTCCATCGGAGCCCGGCGGCGGCGACCAACATGCCGAACGGGGCTCGGCGAGC
GGAGGCGATGGCTCGGCCCCGTCAGCGGCGGACATTGAGGCCCGGACCGTGGCCCTGATGGGCTTGCCAGACACG
GTCAACGACACGCGCATCCGGGCCCTCGTCGAGCCCCTCGGCGCCATCGTCCAGCTCGTCGTCCAGCCCGGTCAC
GGCGGGGCCAAGATCGAATTCGCCGATGCCTCCACCGCCGGAAAAGCGGCCCTCCAGCTCGACGGCCTCGATTTT
GACGGCAACAAGCTACGCACCGGCTCCGTCGGGGACCTCCGCCGCGCCAAAGCCGACCGGACCGACGACCGTATC
GTCTACGGCGGCAGCAAAGACAAGAAGAGCGCGGCGGGGCCCAGCGAGACGCAAAAGCGCGGCCTCATGCCGCCC
CCCGCGCAGATCCGTCGCGCCGGTCCCAAACGCGGCGTGGGATTCCCGCCCCGGCATCGCGAGGCGAAAGCCGCA
GAGAATGGGAAGGCCGCGCCAAAATCGAATGCCGACTTTAGGGCCATGCTCCTGGGCGCTGGCGGAAAAGAGGCT
GAGGAGCCGGAGGAGGTGGTCAAGGGCGAGAGCGACGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail