Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7318
Gene name
Locationscaffold_7:61574..65165
Strand-
Gene length (bp)3591
Transcript length (bp)3591
Coding sequence length (bp)3588
Protein length (aa) 1196

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 1.9E-22 924 1012
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 1.9E-20 1070 1145
PF00271 Helicase_C Helicase conserved C-terminal domain 2.8E-13 733 862
PF00575 S1 S1 RNA binding domain 3.8E-10 228 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 228 1188 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 205 1181 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 216 1181 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 181 1184 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 226 1181 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 228 1188 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 205 1181 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 216 1181 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 181 1184 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 226 1181 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 228 1184 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 214 1186 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 519 1149 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 523 1149 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 523 1149 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 523 1149 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 517 1149 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 512 1160 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 345 1154 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 511 1160 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 352 1150 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 352 1150 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 362 1168 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 525 1166 0.0E+00
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 357 1150 0.0E+00
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 523 1161 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 513 1165 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 526 1165 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 526 1165 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 526 1165 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 526 1165 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 528 1172 0.0E+00
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 526 1173 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 513 1189 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 510 1169 0.0E+00
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 524 1150 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 522 1149 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 522 1149 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 523 1149 0.0E+00
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 449 1158 0.0E+00
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 478 1151 0.0E+00
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 511 1149 0.0E+00
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 526 1148 0.0E+00
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 511 1149 0.0E+00
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 531 1160 0.0E+00
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 531 1154 1.0E-177
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 531 1154 3.0E-177
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 531 1154 9.0E-177
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 531 1154 2.0E-176
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 625 1058 6.0E-171
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 521 1160 9.0E-170
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 513 1140 1.0E-152
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 524 1151 9.0E-144
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 531 1162 1.0E-120
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 531 1153 2.0E-120
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 513 1148 9.0E-120
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 477 1162 2.0E-119
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 531 1180 3.0E-115
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 499 1054 2.0E-113
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 524 1054 8.0E-112
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 524 1144 4.0E-111
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 522 1180 2.0E-109
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 513 1148 2.0E-109
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 524 1148 1.0E-99
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 495 1148 1.0E-94
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 513 1148 2.0E-90
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 528 1105 2.0E-75
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 526 1020 1.0E-74
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 530 1040 2.0E-73
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 523 1113 3.0E-73
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 516 1020 4.0E-73
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 530 1020 5.0E-73
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 530 1040 5.0E-73
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 455 1020 7.0E-73
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 530 1020 9.0E-73
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 524 1046 4.0E-72
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 527 1049 2.0E-69
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 531 1049 2.0E-66
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 523 1059 9.0E-65
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 444 1074 7.0E-63
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 515 1020 3.0E-62
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 500 1020 9.0E-60
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 514 1062 2.0E-59
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 529 996 5.0E-59
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 532 1059 3.0E-58
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 720 1141 1.0E-56
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 720 1141 4.0E-56
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 773 1147 7.0E-56
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 529 985 4.0E-55
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 529 1019 4.0E-55
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 529 1040 6.0E-55
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 529 985 9.0E-55
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 515 1049 2.0E-53
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 515 1049 3.0E-53
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 531 1060 6.0E-53
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 524 767 3.0E-52
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 529 996 4.0E-52
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 724 1135 1.0E-51
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 774 1147 2.0E-51
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 529 1040 2.0E-51
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 529 1015 3.0E-51
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 529 985 3.0E-51
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 524 753 3.0E-51
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 455 985 1.0E-50
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 529 985 2.0E-49
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 524 770 3.0E-49
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 524 760 4.0E-49
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 738 1079 2.0E-48
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 722 1137 2.0E-48
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 509 773 7.0E-48
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 722 1126 1.0E-47
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 739 1053 2.0E-47
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 722 1053 4.0E-47
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 774 1123 2.0E-46
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 728 1093 3.0E-46
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 774 1150 8.0E-46
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 741 1109 8.0E-45
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 528 715 6.0E-44
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 523 715 4.0E-43
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 715 1108 6.0E-43
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 526 935 6.0E-43
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 715 1108 8.0E-43
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 524 715 1.0E-42
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 524 715 1.0E-42
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 740 1137 3.0E-42
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 740 1137 4.0E-41
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 528 734 1.0E-40
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 523 715 1.0E-40
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 528 715 4.0E-40
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 528 715 4.0E-40
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 522 711 9.0E-40
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 774 1155 1.0E-39
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 524 711 2.0E-39
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 740 1137 2.0E-39
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 522 711 3.0E-39
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 528 715 7.0E-38
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 523 715 3.0E-37
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 526 715 4.0E-37
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 741 1109 2.0E-36
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 531 952 3.0E-36
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 510 718 3.0E-35
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 547 950 2.0E-34
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 547 942 2.0E-34
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 547 942 3.0E-34
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 547 942 3.0E-34
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 547 950 3.0E-34
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 741 1059 9.0E-34
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 512 715 2.0E-33
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 523 712 4.0E-33
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 523 712 4.0E-33
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 741 1059 5.0E-33
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 741 1059 5.0E-33
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 741 1059 5.0E-33
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 528 715 7.0E-33
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 523 712 7.0E-31
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 524 715 3.0E-29
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 546 871 5.0E-27
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 741 1133 2.0E-24
sp|Q0AK62|PNP_MARMM Polyribonucleotide nucleotidyltransferase OS=Maricaulis maris (strain MCS10) GN=pnp PE=3 SV=1 228 315 5.0E-15
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 879 1108 6.0E-15
sp|Q28K17|PNP_JANSC Polyribonucleotide nucleotidyltransferase OS=Jannaschia sp. (strain CCS1) GN=pnp PE=3 SV=1 228 309 3.0E-14
sp|A1B5P9|PNP_PARDP Polyribonucleotide nucleotidyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=pnp PE=3 SV=2 228 320 7.0E-14
sp|Q21C27|PNP_RHOPB Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=pnp PE=3 SV=1 228 323 2.0E-13
sp|Q5LN23|PNP_RUEPO Polyribonucleotide nucleotidyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pnp PE=3 SV=1 228 317 2.0E-13
sp|A8LKE7|PNP_DINSH Polyribonucleotide nucleotidyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pnp PE=3 SV=1 228 316 4.0E-13
sp|Q2G5F5|PNP_NOVAD Polyribonucleotide nucleotidyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pnp PE=3 SV=1 224 313 4.0E-13
sp|Q5NQ32|PNP_ZYMMO Polyribonucleotide nucleotidyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pnp PE=3 SV=1 224 313 7.0E-13
sp|Q13EM2|PNP_RHOPS Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=pnp PE=3 SV=1 228 326 7.0E-13
sp|B9KP47|PNP_RHOSK Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pnp PE=3 SV=1 228 317 1.0E-12
sp|Q3SWP5|PNP_NITWN Polyribonucleotide nucleotidyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pnp PE=3 SV=1 228 328 1.0E-12
sp|Q1GKK5|PNP_RUEST Polyribonucleotide nucleotidyltransferase OS=Ruegeria sp. (strain TM1040) GN=pnp PE=3 SV=1 228 317 2.0E-12
sp|A4WWP0|PNP_RHOS5 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pnp PE=3 SV=2 228 317 2.0E-12
sp|Q16CF6|PNP_ROSDO Polyribonucleotide nucleotidyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pnp PE=3 SV=1 228 315 3.0E-12
sp|B3QAB0|PNP_RHOPT Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pnp PE=3 SV=1 228 326 3.0E-12
sp|Q2NBZ2|PNP_ERYLH Polyribonucleotide nucleotidyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=pnp PE=3 SV=1 224 313 4.0E-12
sp|Q6NCN8|PNP_RHOPA Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pnp PE=3 SV=1 228 326 5.0E-12
sp|B8EP09|PNP_METSB Polyribonucleotide nucleotidyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=pnp PE=3 SV=1 228 325 5.0E-12
sp|A7IC03|PNP_XANP2 Polyribonucleotide nucleotidyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pnp PE=3 SV=1 228 313 7.0E-12
sp|Q3IYT7|PNP_RHOS4 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pnp PE=3 SV=1 228 314 8.0E-12
sp|A3PNG0|PNP_RHOS1 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pnp PE=3 SV=1 228 314 8.0E-12
sp|Q07V82|PNP_RHOP5 Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=pnp PE=3 SV=1 228 312 1.0E-11
sp|A8IGA3|PNP_AZOC5 Polyribonucleotide nucleotidyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pnp PE=3 SV=2 228 317 1.0E-11
sp|A5E870|PNP_BRASB Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pnp PE=3 SV=1 228 322 2.0E-11
sp|Q2J2J4|PNP_RHOP2 Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=pnp PE=3 SV=1 228 328 2.0E-11
sp|Q9AC32|PNP_CAUCR Polyribonucleotide nucleotidyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pnp PE=1 SV=1 224 312 3.0E-11
sp|B8GWZ0|PNP_CAUCN Polyribonucleotide nucleotidyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pnp PE=3 SV=1 224 312 3.0E-11
sp|B4RC48|PNP_PHEZH Polyribonucleotide nucleotidyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=pnp PE=3 SV=1 228 312 3.0E-11
sp|B6JCR8|PNP_OLICO Polyribonucleotide nucleotidyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pnp PE=3 SV=1 228 317 3.0E-11
sp|Q8FXS9|PNP_BRUSU Polyribonucleotide nucleotidyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=pnp PE=3 SV=1 228 317 3.0E-11
sp|A5VTB6|PNP_BRUO2 Polyribonucleotide nucleotidyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pnp PE=3 SV=1 228 317 3.0E-11
sp|B0CK15|PNP_BRUSI Polyribonucleotide nucleotidyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|Q8YEB7|PNP_BRUME Polyribonucleotide nucleotidyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|C0RG51|PNP_BRUMB Polyribonucleotide nucleotidyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|A9M9Z8|PNP_BRUC2 Polyribonucleotide nucleotidyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|Q57A96|PNP_BRUAB Polyribonucleotide nucleotidyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|Q2YQR3|PNP_BRUA2 Polyribonucleotide nucleotidyltransferase OS=Brucella abortus (strain 2308) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|B2S9G0|PNP_BRUA1 Polyribonucleotide nucleotidyltransferase OS=Brucella abortus (strain S19) GN=pnp PE=3 SV=1 228 317 4.0E-11
sp|Q1QS60|PNP_NITHX Polyribonucleotide nucleotidyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pnp PE=3 SV=2 228 313 5.0E-11
sp|Q89WB3|PNP_BRADU Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pnp PE=3 SV=1 228 321 6.0E-11
sp|A6WWW1|PNP_OCHA4 Polyribonucleotide nucleotidyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pnp PE=3 SV=1 228 317 8.0E-11
sp|B2ICY4|PNP_BEII9 Polyribonucleotide nucleotidyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=pnp PE=3 SV=1 228 313 9.0E-11
sp|A9W8P8|PNP_METEP Polyribonucleotide nucleotidyltransferase OS=Methylobacterium extorquens (strain PA1) GN=pnp PE=3 SV=2 228 312 1.0E-10
sp|B7KN55|PNP_METC4 Polyribonucleotide nucleotidyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pnp PE=3 SV=1 228 312 1.0E-10
sp|Q0BWM9|PNP_HYPNA Polyribonucleotide nucleotidyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pnp PE=3 SV=1 229 316 1.0E-10
sp|A5VCY9|PNP_SPHWW Polyribonucleotide nucleotidyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pnp PE=3 SV=1 228 317 1.0E-10
sp|Q2KE00|PNP_RHIEC Polyribonucleotide nucleotidyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pnp PE=3 SV=1 228 317 1.0E-10
sp|A9IMR9|PNP_BART1 Polyribonucleotide nucleotidyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pnp PE=3 SV=1 224 312 1.0E-10
sp|A9CKQ7|PNP_AGRFC Polyribonucleotide nucleotidyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pnp PE=3 SV=1 228 317 1.0E-10
sp|B0T175|PNP_CAUSK Polyribonucleotide nucleotidyltransferase OS=Caulobacter sp. (strain K31) GN=pnp PE=3 SV=1 224 319 1.0E-10
sp|Q11BC3|PNP_CHESB Polyribonucleotide nucleotidyltransferase OS=Chelativorans sp. (strain BNC1) GN=pnp PE=3 SV=1 228 309 1.0E-10
sp|B3PXD7|PNP_RHIE6 Polyribonucleotide nucleotidyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pnp PE=3 SV=2 228 317 2.0E-10
sp|A4YJF3|PNP_BRASO Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pnp PE=3 SV=1 228 317 2.0E-10
sp|Q9NP64|NO40_HUMAN Nucleolar protein of 40 kDa OS=Homo sapiens GN=ZCCHC17 PE=1 SV=1 224 316 2.0E-10
sp|A6UF34|PNP_SINMW Polyribonucleotide nucleotidyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pnp PE=3 SV=1 228 317 2.0E-10
sp|Q9ESX4|NO40_MOUSE Nucleolar protein of 40 kDa OS=Mus musculus GN=Zcchc17 PE=1 SV=1 222 316 2.0E-10
sp|B5ZW24|PNP_RHILW Polyribonucleotide nucleotidyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pnp PE=3 SV=1 228 317 2.0E-10
sp|A5FVG2|PNP_ACICJ Polyribonucleotide nucleotidyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=pnp PE=3 SV=1 208 312 3.0E-10
sp|B9JGS9|PNP_AGRRK Polyribonucleotide nucleotidyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pnp PE=3 SV=1 228 312 3.0E-10
sp|C3MC71|PNP_RHISN Polyribonucleotide nucleotidyltransferase OS=Rhizobium sp. (strain NGR234) GN=pnp PE=3 SV=1 228 315 3.0E-10
sp|Q1MN44|PNP_RHIL3 Polyribonucleotide nucleotidyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pnp PE=3 SV=1 228 317 4.0E-10
sp|Q5FQL9|PNP_GLUOX Polyribonucleotide nucleotidyltransferase OS=Gluconobacter oxydans (strain 621H) GN=pnp PE=3 SV=1 208 312 4.0E-10
sp|Q98BI3|PNP_RHILO Polyribonucleotide nucleotidyltransferase OS=Rhizobium loti (strain MAFF303099) GN=pnp PE=3 SV=1 228 317 4.0E-10
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 717 1108 4.0E-10
sp|Q2RMR6|PNP_RHORT Polyribonucleotide nucleotidyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pnp PE=3 SV=1 228 316 5.0E-10
sp|Q1GVQ8|PNP_SPHAL Polyribonucleotide nucleotidyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pnp PE=3 SV=1 224 313 5.0E-10
sp|A1UU54|PNP_BARBK Polyribonucleotide nucleotidyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pnp PE=3 SV=1 224 309 5.0E-10
sp|Q92SW0|PNP_RHIME Polyribonucleotide nucleotidyltransferase OS=Rhizobium meliloti (strain 1021) GN=pnp PE=3 SV=1 228 315 5.0E-10
sp|Q6G5F8|PNP_BARHE Polyribonucleotide nucleotidyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pnp PE=3 SV=1 218 309 8.0E-10
sp|B3GXC1|PNP_ACTP7 Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pnp PE=3 SV=2 208 308 8.0E-10
sp|A3MZU3|PNP_ACTP2 Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pnp PE=3 SV=1 208 308 8.0E-10
sp|B0BUD5|PNP_ACTPJ Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pnp PE=3 SV=1 208 308 9.0E-10
sp|Q4FNM6|PNP_PELUB Polyribonucleotide nucleotidyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=pnp PE=3 SV=1 229 302 9.0E-10
sp|A9HF35|PNP_GLUDA Polyribonucleotide nucleotidyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=pnp PE=3 SV=1 228 312 1.0E-09
sp|Q0BPK3|PNP_GRABC Polyribonucleotide nucleotidyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pnp PE=3 SV=1 228 312 1.0E-09
sp|B8F492|PNP_HAEPS Polyribonucleotide nucleotidyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pnp PE=3 SV=1 208 307 2.0E-09
sp|B6IVG3|PNP_RHOCS Polyribonucleotide nucleotidyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pnp PE=3 SV=1 228 312 2.0E-09
sp|A7HZ97|PNP_PARL1 Polyribonucleotide nucleotidyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pnp PE=3 SV=1 228 309 2.0E-09
sp|A5N848|PNP_CLOK5 Polyribonucleotide nucleotidyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pnp PE=3 SV=1 230 308 2.0E-09
sp|B9E1K8|PNP_CLOK1 Polyribonucleotide nucleotidyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=pnp PE=3 SV=2 230 308 2.0E-09
sp|Q2VZQ4|PNP_MAGSA Polyribonucleotide nucleotidyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pnp PE=3 SV=1 228 315 2.0E-09
sp|A6VU33|PNP_MARMS Polyribonucleotide nucleotidyltransferase OS=Marinomonas sp. (strain MWYL1) GN=pnp PE=3 SV=1 223 307 2.0E-09
sp|Q7VL91|PNP_HAEDU Polyribonucleotide nucleotidyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pnp PE=3 SV=1 208 316 8.0E-09
sp|Q2SMK9|PNP_HAHCH Polyribonucleotide nucleotidyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=pnp PE=3 SV=1 223 307 8.0E-09
sp|B9JYL0|PNP_AGRVS Polyribonucleotide nucleotidyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pnp PE=3 SV=1 228 309 9.0E-09
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 550 981 1.0E-08
sp|P14129|RS1_RHIME 30S ribosomal protein S1 OS=Rhizobium meliloti (strain 1021) GN=rpsA PE=3 SV=2 201 307 2.0E-08
sp|Q4L6I1|RS1_STAHJ 30S ribosomal protein S1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsA PE=3 SV=1 233 303 3.0E-08
sp|Q98218|NPH2_MCV1 RNA helicase NPH-II OS=Molluscum contagiosum virus subtype 1 GN=NPH2 PE=3 SV=1 646 873 3.0E-08
sp|P46836|RS1_MYCLE 30S ribosomal protein S1 OS=Mycobacterium leprae (strain TN) GN=rpsA PE=3 SV=2 229 307 3.0E-08
sp|P9WH43|RS1_MYCTU 30S ribosomal protein S1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsA PE=1 SV=1 229 307 4.0E-08
sp|P9WH42|RS1_MYCTO 30S ribosomal protein S1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsA PE=3 SV=1 229 307 4.0E-08
sp|A0QYY6|RS1_MYCS2 30S ribosomal protein S1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsA PE=1 SV=1 229 307 4.0E-08
sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic virus PE=3 SV=2 543 869 6.0E-08
sp|Q1QSZ4|PNP_CHRSD Polyribonucleotide nucleotidyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pnp PE=3 SV=1 228 304 7.0E-08
sp|A1U5Z6|PNP_MARHV Polyribonucleotide nucleotidyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pnp PE=3 SV=1 223 306 7.0E-08
sp|P38494|RS1H_BACSU 30S ribosomal protein S1 homolog OS=Bacillus subtilis (strain 168) GN=ypfD PE=1 SV=1 229 303 1.0E-07
sp|P90245|POL1_BAMMN Genome polyprotein 1 OS=Barley mild mosaic virus (strain Na1) PE=3 SV=1 552 866 1.0E-07
sp|Q6FF12|PNP_ACIAD Polyribonucleotide nucleotidyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pnp PE=3 SV=1 232 306 1.0E-07
sp|Q5L0I2|PNP_GEOKA Polyribonucleotide nucleotidyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=pnp PE=3 SV=1 209 321 2.0E-07
sp|A4IME3|PNP_GEOTN Polyribonucleotide nucleotidyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pnp PE=3 SV=1 209 321 2.0E-07
sp|Q9Q8Q2|NPH2_MYXVL RNA helicase NPH-II OS=Myxoma virus (strain Lausanne) GN=NPH2 PE=3 SV=1 550 943 2.0E-07
sp|Q6NDP1|RS1_RHOPA 30S ribosomal protein S1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsA PE=1 SV=1 201 307 2.0E-07
sp|Q2GJV5|PNP_ANAPZ Polyribonucleotide nucleotidyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=pnp PE=3 SV=1 228 346 2.0E-07
sp|P50889|RS1_LEULA 30S ribosomal protein S1 OS=Leuconostoc lactis GN=rps1 PE=2 SV=2 230 302 3.0E-07
sp|O06000|RS1H_BACC1 30S ribosomal protein S1 homolog OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_1625 PE=3 SV=1 233 302 6.0E-07
sp|Q83E09|RS1_COXBU 30S ribosomal protein S1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsA PE=1 SV=1 235 307 6.0E-07
sp|Q97I45|PNP_CLOAB Polyribonucleotide nucleotidyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pnp PE=3 SV=1 229 304 7.0E-07
sp|P89201|POLG_SPMMV Genome polyprotein OS=Sweet potato mild mottle virus (isolate Salazar) PE=2 SV=1 552 869 7.0E-07
sp|Q49XT0|RS1_STAS1 30S ribosomal protein S1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsA PE=3 SV=1 233 303 1.0E-06
sp|A5CWW8|PNP_VESOH Polyribonucleotide nucleotidyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pnp PE=3 SV=1 207 302 2.0E-06
sp|C5BPV5|PNP_TERTT Polyribonucleotide nucleotidyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pnp PE=3 SV=1 223 313 2.0E-06
sp|C5D9D5|PNP_GEOSW Polyribonucleotide nucleotidyltransferase OS=Geobacillus sp. (strain WCH70) GN=pnp PE=3 SV=1 210 307 2.0E-06
sp|C0QHM6|PNP_DESAH Polyribonucleotide nucleotidyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pnp PE=3 SV=1 209 307 2.0E-06
sp|O34275|PNP_YEREN Polyribonucleotide nucleotidyltransferase OS=Yersinia enterocolitica GN=pnp PE=3 SV=2 223 303 2.0E-06
sp|A1JIX3|PNP_YERE8 Polyribonucleotide nucleotidyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pnp PE=3 SV=1 223 303 2.0E-06
sp|C1F8M1|PNP_ACIC5 Polyribonucleotide nucleotidyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pnp PE=3 SV=1 219 304 2.0E-06
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) PE=1 SV=2 556 868 3.0E-06
sp|Q1IF39|PNP_PSEE4 Polyribonucleotide nucleotidyltransferase OS=Pseudomonas entomophila (strain L48) GN=pnp PE=3 SV=1 229 304 4.0E-06
sp|O36979|POLG_ZYMVS Genome polyprotein OS=Zucchini yellow mosaic virus (strain Singapore) PE=3 SV=2 550 887 4.0E-06
sp|Q127W8|PNP_POLSJ Polyribonucleotide nucleotidyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pnp PE=3 SV=1 223 302 4.0E-06
sp|B7GG69|PNP_ANOFW Polyribonucleotide nucleotidyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pnp PE=3 SV=1 209 307 4.0E-06
sp|Q9JZ44|RS1_NEIMB 30S ribosomal protein S1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsA PE=1 SV=1 229 307 4.0E-06
sp|Q82ZJ2|PNP_ENTFA Polyribonucleotide nucleotidyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pnp PE=3 SV=1 229 293 4.0E-06
sp|A2SFM2|PNP_METPP Polyribonucleotide nucleotidyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=pnp PE=3 SV=1 223 302 5.0E-06
sp|P21530|POLG_CSFVB Genome polyprotein OS=Classical swine fever virus (strain Brescia) PE=2 SV=1 556 868 5.0E-06
sp|Q5NZR7|PNP_AROAE Polyribonucleotide nucleotidyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=pnp PE=3 SV=1 229 302 5.0E-06
sp|P14128|RS1_PROSP 30S ribosomal protein S1 (Fragment) OS=Providencia sp. GN=rpsA PE=3 SV=1 205 307 5.0E-06
sp|B1Y823|PNP_LEPCP Polyribonucleotide nucleotidyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pnp PE=3 SV=1 229 313 5.0E-06
sp|A5EXU0|PNP_DICNV Polyribonucleotide nucleotidyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=pnp PE=3 SV=1 218 303 5.0E-06
sp|B9KIE3|PNP_ANAMF Polyribonucleotide nucleotidyltransferase OS=Anaplasma marginale (strain Florida) GN=pnp PE=3 SV=1 228 340 6.0E-06
sp|Q4FVL0|PNP_PSYA2 Polyribonucleotide nucleotidyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pnp PE=3 SV=1 205 306 7.0E-06
sp|A1K7B5|PNP_AZOSB Polyribonucleotide nucleotidyltransferase OS=Azoarcus sp. (strain BH72) GN=pnp PE=3 SV=1 229 302 7.0E-06
sp|A1WLP8|PNP_VEREI Polyribonucleotide nucleotidyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pnp PE=3 SV=1 229 328 7.0E-06
sp|A1VM56|PNP_POLNA Polyribonucleotide nucleotidyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pnp PE=3 SV=1 223 302 8.0E-06
sp|Q8RIA1|PNP_FUSNN Polyribonucleotide nucleotidyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pnp PE=3 SV=1 229 304 9.0E-06
sp|B2KDX2|PNP_ELUMP Polyribonucleotide nucleotidyltransferase OS=Elusimicrobium minutum (strain Pei191) GN=pnp PE=3 SV=1 229 302 1.0E-05
sp|Q1QEN9|PNP_PSYCK Polyribonucleotide nucleotidyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=pnp PE=3 SV=1 205 306 1.0E-05
sp|Q7A5J0|RS1_STAAN 30S ribosomal protein S1 OS=Staphylococcus aureus (strain N315) GN=rpsA PE=1 SV=1 204 303 1.0E-05
sp|Q99U14|RS1_STAAM 30S ribosomal protein S1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsA PE=3 SV=1 204 303 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0004386 helicase activity Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7318
MDEVTNLEYLSLVSKVVSELQNHVGISDKKLAEFLIFHRAEKSSSIEDFRKWLNTINNPFPESFVNSLDRLVLAL
HPKLNKNGENARPSRTLEDKEKTFSGLALPDQQPQTDERGGGDAIDDTLALLEGLENRASGYSSKRRSQSPKDVD
RRRRRSRSPKDADRRRRRDRSRSTDRRKRGIRVPDDEDWRGDDYRESRKGRRGSRRFNDNESNARLDRALEPEID
EVPQLNKIYKGHVTGITNFGAFVNLHNVRGKVDGLVHVSRLSAGQRVNHPSDLVSKGQHVFVKLVSIEGSKIGLS
MKDVEQDTGIDLEPESRFSTGANMEALGGGNRRGFGGEASVMPPDGIGVPLARHRKRMTSPERWEIRQLIASGVA
KASDFPELEEDYNASLRGHGELELEEDVDIEVRDEEPPFLAGQTKQSLELSPIRVVKAPDGSMNRAAMAGSVFAK
ERKELKRQEAETKEEPKENLSSQWLDPMADPDKRKFASDMRTARTNPKPEEAPEWKKAVIPRGQPLGKRTNLSMQ
EQRRQLPVFAFRSQLIQAIKDNQILIVVGETGSGKTTQLTQYLAEAGFASKGGIIGCTQPRRVAAMSVAKRVAEE
VGCKTGQQVGYTIRFEDCTSPKTIIKYMTDGMLQREILMDPDMGRYSVIMLDEAHERTISTDVLFALLKKALKRR
PDLKVIVTSATLDADKFSAYFNECPIFTIPGRTFPVEILYSREPESDYLDAALVTVMQIHLTEPKGDILLFLTGQ
EEIDTACETLFDRMKALGPSVPELIILPVYSQLPTEMQSRIFEPAPPGSRKVVIATNIAETSITIDEIYYVVDPG
FVKQNAYDPKLGMDSLVVTPVSQAQANQRSGRAGRTGPGKCFRLYTEAAYQSEMLPTTIPEIQRQNLAHTILMLK
AMGINDLLHFDFMDPPPVNSMLTALEELYALSALDDEGLLTRLGRKMADFPMEPSLAKVLIAAIDHNCSDEILSL
VAMLNMPNVFYRPKEKQQQADQKKSKFHDPHGDHLTLLNVYNAWKHSGFSNPWCFENFIQARSMRRAKDVRDQLL
KIMKRYRIPVVSCGRDTHKVRRALCCGFFRNAARKDPHEGYKTLIEGTPVYLHPSSALFGKHAEWVIYHTLVLTD
KEYMHCTTSIEPKWLVEAAPTFFKVAPSDRLSKRKQAERIQPLYNRFAGEDDWRLSAQRRGGRGGGGSTWG
Coding >Ophio5|7318
ATGGACGAGGTAACGAACCTCGAGTATCTCTCGCTCGTCTCAAAGGTCGTTTCCGAGCTTCAAAATCACGTGGGA
ATTAGCGACAAGAAACTCGCCGAGTTTCTCATCTTCCACCGCGCCGAAAAGAGCAGCTCCATCGAGGACTTTCGG
AAATGGCTCAACACCATCAACAACCCCTTCCCCGAGAGCTTCGTCAACAGTCTAGACCGCCTGGTTTTGGCGCTC
CATCCCAAGCTCAATAAGAACGGCGAGAATGCTCGACCCTCGCGCACACTCGAGGACAAGGAGAAGACGTTCAGC
GGACTCGCTCTGCCGGACCAGCAGCCACAGACTGACGAGAGAGGCGGCGGCGACGCCATCGATGATACACTGGCG
CTTTTGGAGGGTCTGGAGAACAGGGCCTCGGGGTACTCATCCAAGAGGCGCAGCCAGAGTCCCAAGGATGTGGAT
AGGCGGAGGAGGCGAAGCCGGAGTCCCAAAGATGCGGATAGGCGGAGGAGGCGAGACAGGTCCCGCTCAACAGAT
CGGCGCAAGAGAGGCATTCGCGTTCCTGACGATGAAGACTGGCGAGGCGACGACTATCGCGAATCGCGAAAGGGT
AGACGCGGCAGCAGGCGCTTCAACGACAATGAGAGCAACGCCCGACTCGACAGAGCGTTGGAACCCGAGATCGAC
GAGGTGCCTCAACTGAACAAGATTTATAAGGGTCATGTCACTGGAATCACGAACTTTGGCGCCTTTGTCAACCTG
CATAACGTTCGTGGCAAGGTCGACGGCCTTGTTCACGTCTCTCGTCTTTCGGCCGGTCAGCGCGTCAACCATCCC
TCCGACCTTGTCTCAAAGGGACAGCATGTGTTCGTCAAGCTGGTCAGTATCGAGGGCTCCAAAATCGGCCTTTCG
ATGAAGGATGTGGAACAAGATACAGGCATAGATCTTGAGCCTGAGTCACGGTTTTCCACCGGTGCCAATATGGAG
GCCCTAGGCGGCGGCAACAGGCGAGGCTTTGGAGGAGAGGCCTCCGTGATGCCGCCCGATGGCATTGGAGTTCCC
CTTGCGCGCCACAGGAAGAGGATGACGTCGCCTGAGAGGTGGGAAATTCGCCAGCTCATCGCGTCAGGCGTAGCC
AAAGCCTCCGACTTTCCCGAACTGGAAGAAGACTACAACGCGAGCCTGCGCGGCCATGGCGAGCTGGAGCTGGAA
GAGGACGTCGACATCGAGGTCAGGGACGAGGAACCGCCTTTCTTGGCTGGCCAGACCAAGCAGTCCCTGGAGCTC
TCGCCAATCCGAGTTGTGAAGGCGCCCGACGGGTCCATGAACCGAGCCGCCATGGCAGGCTCCGTCTTCGCCAAG
GAGAGGAAGGAGCTGAAGCGGCAGGAGGCCGAAACCAAGGAGGAGCCCAAGGAGAACCTGTCATCTCAATGGCTG
GACCCCATGGCGGATCCGGACAAGCGCAAGTTCGCGAGCGATATGAGGACCGCTCGCACGAACCCGAAGCCCGAG
GAGGCGCCCGAGTGGAAGAAGGCCGTCATCCCCAGGGGACAGCCTCTGGGGAAGCGCACCAATCTGAGCATGCAG
GAGCAGCGACGCCAGCTGCCCGTCTTCGCCTTCCGCAGCCAGCTCATACAGGCCATCAAGGACAACCAAATTCTC
ATAGTCGTGGGTGAGACCGGATCGGGCAAGACGACTCAGCTCACGCAATACCTGGCGGAGGCGGGCTTCGCAAGC
AAGGGGGGCATCATCGGGTGCACGCAGCCACGTCGAGTGGCGGCCATGTCGGTCGCCAAGCGCGTGGCCGAGGAG
GTCGGGTGCAAGACGGGGCAACAAGTCGGATATACCATCCGGTTCGAGGATTGCACGAGTCCAAAGACGATCATC
AAGTACATGACAGATGGCATGCTACAGCGGGAGATTCTCATGGACCCGGATATGGGGCGATATTCGGTCATTATG
CTCGACGAGGCACACGAGCGAACCATTTCGACTGATGTTCTATTTGCACTGCTCAAGAAGGCTCTCAAGCGGAGG
CCCGATCTCAAGGTCATCGTCACATCGGCCACGCTCGATGCCGATAAATTCTCAGCCTACTTTAACGAGTGTCCC
ATCTTTACCATCCCCGGGCGGACGTTTCCAGTCGAGATCCTCTACTCGAGGGAGCCCGAGTCAGACTATCTGGAC
GCGGCCCTCGTCACGGTGATGCAGATTCATCTCACGGAGCCCAAGGGTGACATTCTGCTCTTCCTCACGGGCCAG
GAGGAGATTGACACGGCGTGCGAGACGCTGTTTGACCGGATGAAGGCTCTGGGGCCTAGCGTGCCGGAACTCATC
ATTCTTCCCGTCTATTCTCAGCTTCCCACGGAAATGCAGAGCCGCATCTTTGAACCAGCTCCACCGGGAAGTCGC
AAGGTCGTCATCGCGACGAATATTGCCGAGACGTCCATCACCATCGACGAGATCTATTACGTTGTTGATCCGGGC
TTCGTCAAGCAGAACGCCTACGACCCGAAGCTCGGCATGGATTCGCTCGTCGTCACGCCAGTCTCACAGGCGCAG
GCGAACCAGAGGTCCGGGCGAGCCGGGCGCACGGGGCCCGGCAAGTGTTTCCGGCTCTACACAGAGGCCGCCTAT
CAGTCGGAGATGCTACCGACGACGATACCGGAGATACAGAGGCAGAATTTGGCGCATACCATCCTTATGCTCAAG
GCTATGGGCATCAACGATCTACTGCACTTTGACTTTATGGACCCGCCGCCTGTCAACTCGATGCTTACGGCGCTC
GAGGAGCTGTACGCGCTGAGTGCGCTCGACGATGAAGGTCTTTTGACGCGTCTCGGTCGCAAGATGGCCGACTTT
CCGATGGAGCCATCGCTGGCCAAGGTGCTGATTGCGGCCATCGACCACAACTGCTCGGACGAGATTCTGAGTCTC
GTCGCAATGCTCAATATGCCCAATGTTTTTTACCGGCCGAAAGAGAAGCAGCAGCAGGCGGATCAGAAGAAGTCC
AAGTTCCACGACCCTCACGGCGACCACCTGACGCTGCTCAACGTGTACAACGCCTGGAAGCACAGCGGCTTCTCC
AACCCGTGGTGCTTCGAAAACTTCATCCAGGCGCGGTCGATGCGGCGGGCTAAAGACGTGCGTGACCAGCTACTC
AAGATCATGAAACGCTATCGGATTCCCGTCGTGTCGTGTGGACGCGACACGCACAAGGTGCGACGAGCCCTGTGC
TGCGGCTTCTTCCGCAACGCGGCGCGTAAGGATCCTCACGAGGGCTACAAGACGCTCATCGAGGGCACGCCCGTC
TACCTGCACCCGAGCTCGGCGCTGTTCGGCAAGCACGCCGAATGGGTCATCTATCATACCCTGGTTCTGACGGAC
AAGGAGTACATGCACTGTACCACCAGTATCGAGCCCAAGTGGCTGGTCGAGGCGGCTCCGACATTCTTCAAGGTG
GCCCCGTCGGATAGGCTGAGCAAGCGGAAGCAGGCCGAGCGGATCCAGCCACTGTATAATCGGTTTGCTGGCGAG
GACGACTGGCGTTTGAGCGCGCAGCGGCGCGGCGGCAGGGGCGGCGGTGGCAGCACTTGGGGT
Transcript >Ophio5|7318
ATGGACGAGGTAACGAACCTCGAGTATCTCTCGCTCGTCTCAAAGGTCGTTTCCGAGCTTCAAAATCACGTGGGA
ATTAGCGACAAGAAACTCGCCGAGTTTCTCATCTTCCACCGCGCCGAAAAGAGCAGCTCCATCGAGGACTTTCGG
AAATGGCTCAACACCATCAACAACCCCTTCCCCGAGAGCTTCGTCAACAGTCTAGACCGCCTGGTTTTGGCGCTC
CATCCCAAGCTCAATAAGAACGGCGAGAATGCTCGACCCTCGCGCACACTCGAGGACAAGGAGAAGACGTTCAGC
GGACTCGCTCTGCCGGACCAGCAGCCACAGACTGACGAGAGAGGCGGCGGCGACGCCATCGATGATACACTGGCG
CTTTTGGAGGGTCTGGAGAACAGGGCCTCGGGGTACTCATCCAAGAGGCGCAGCCAGAGTCCCAAGGATGTGGAT
AGGCGGAGGAGGCGAAGCCGGAGTCCCAAAGATGCGGATAGGCGGAGGAGGCGAGACAGGTCCCGCTCAACAGAT
CGGCGCAAGAGAGGCATTCGCGTTCCTGACGATGAAGACTGGCGAGGCGACGACTATCGCGAATCGCGAAAGGGT
AGACGCGGCAGCAGGCGCTTCAACGACAATGAGAGCAACGCCCGACTCGACAGAGCGTTGGAACCCGAGATCGAC
GAGGTGCCTCAACTGAACAAGATTTATAAGGGTCATGTCACTGGAATCACGAACTTTGGCGCCTTTGTCAACCTG
CATAACGTTCGTGGCAAGGTCGACGGCCTTGTTCACGTCTCTCGTCTTTCGGCCGGTCAGCGCGTCAACCATCCC
TCCGACCTTGTCTCAAAGGGACAGCATGTGTTCGTCAAGCTGGTCAGTATCGAGGGCTCCAAAATCGGCCTTTCG
ATGAAGGATGTGGAACAAGATACAGGCATAGATCTTGAGCCTGAGTCACGGTTTTCCACCGGTGCCAATATGGAG
GCCCTAGGCGGCGGCAACAGGCGAGGCTTTGGAGGAGAGGCCTCCGTGATGCCGCCCGATGGCATTGGAGTTCCC
CTTGCGCGCCACAGGAAGAGGATGACGTCGCCTGAGAGGTGGGAAATTCGCCAGCTCATCGCGTCAGGCGTAGCC
AAAGCCTCCGACTTTCCCGAACTGGAAGAAGACTACAACGCGAGCCTGCGCGGCCATGGCGAGCTGGAGCTGGAA
GAGGACGTCGACATCGAGGTCAGGGACGAGGAACCGCCTTTCTTGGCTGGCCAGACCAAGCAGTCCCTGGAGCTC
TCGCCAATCCGAGTTGTGAAGGCGCCCGACGGGTCCATGAACCGAGCCGCCATGGCAGGCTCCGTCTTCGCCAAG
GAGAGGAAGGAGCTGAAGCGGCAGGAGGCCGAAACCAAGGAGGAGCCCAAGGAGAACCTGTCATCTCAATGGCTG
GACCCCATGGCGGATCCGGACAAGCGCAAGTTCGCGAGCGATATGAGGACCGCTCGCACGAACCCGAAGCCCGAG
GAGGCGCCCGAGTGGAAGAAGGCCGTCATCCCCAGGGGACAGCCTCTGGGGAAGCGCACCAATCTGAGCATGCAG
GAGCAGCGACGCCAGCTGCCCGTCTTCGCCTTCCGCAGCCAGCTCATACAGGCCATCAAGGACAACCAAATTCTC
ATAGTCGTGGGTGAGACCGGATCGGGCAAGACGACTCAGCTCACGCAATACCTGGCGGAGGCGGGCTTCGCAAGC
AAGGGGGGCATCATCGGGTGCACGCAGCCACGTCGAGTGGCGGCCATGTCGGTCGCCAAGCGCGTGGCCGAGGAG
GTCGGGTGCAAGACGGGGCAACAAGTCGGATATACCATCCGGTTCGAGGATTGCACGAGTCCAAAGACGATCATC
AAGTACATGACAGATGGCATGCTACAGCGGGAGATTCTCATGGACCCGGATATGGGGCGATATTCGGTCATTATG
CTCGACGAGGCACACGAGCGAACCATTTCGACTGATGTTCTATTTGCACTGCTCAAGAAGGCTCTCAAGCGGAGG
CCCGATCTCAAGGTCATCGTCACATCGGCCACGCTCGATGCCGATAAATTCTCAGCCTACTTTAACGAGTGTCCC
ATCTTTACCATCCCCGGGCGGACGTTTCCAGTCGAGATCCTCTACTCGAGGGAGCCCGAGTCAGACTATCTGGAC
GCGGCCCTCGTCACGGTGATGCAGATTCATCTCACGGAGCCCAAGGGTGACATTCTGCTCTTCCTCACGGGCCAG
GAGGAGATTGACACGGCGTGCGAGACGCTGTTTGACCGGATGAAGGCTCTGGGGCCTAGCGTGCCGGAACTCATC
ATTCTTCCCGTCTATTCTCAGCTTCCCACGGAAATGCAGAGCCGCATCTTTGAACCAGCTCCACCGGGAAGTCGC
AAGGTCGTCATCGCGACGAATATTGCCGAGACGTCCATCACCATCGACGAGATCTATTACGTTGTTGATCCGGGC
TTCGTCAAGCAGAACGCCTACGACCCGAAGCTCGGCATGGATTCGCTCGTCGTCACGCCAGTCTCACAGGCGCAG
GCGAACCAGAGGTCCGGGCGAGCCGGGCGCACGGGGCCCGGCAAGTGTTTCCGGCTCTACACAGAGGCCGCCTAT
CAGTCGGAGATGCTACCGACGACGATACCGGAGATACAGAGGCAGAATTTGGCGCATACCATCCTTATGCTCAAG
GCTATGGGCATCAACGATCTACTGCACTTTGACTTTATGGACCCGCCGCCTGTCAACTCGATGCTTACGGCGCTC
GAGGAGCTGTACGCGCTGAGTGCGCTCGACGATGAAGGTCTTTTGACGCGTCTCGGTCGCAAGATGGCCGACTTT
CCGATGGAGCCATCGCTGGCCAAGGTGCTGATTGCGGCCATCGACCACAACTGCTCGGACGAGATTCTGAGTCTC
GTCGCAATGCTCAATATGCCCAATGTTTTTTACCGGCCGAAAGAGAAGCAGCAGCAGGCGGATCAGAAGAAGTCC
AAGTTCCACGACCCTCACGGCGACCACCTGACGCTGCTCAACGTGTACAACGCCTGGAAGCACAGCGGCTTCTCC
AACCCGTGGTGCTTCGAAAACTTCATCCAGGCGCGGTCGATGCGGCGGGCTAAAGACGTGCGTGACCAGCTACTC
AAGATCATGAAACGCTATCGGATTCCCGTCGTGTCGTGTGGACGCGACACGCACAAGGTGCGACGAGCCCTGTGC
TGCGGCTTCTTCCGCAACGCGGCGCGTAAGGATCCTCACGAGGGCTACAAGACGCTCATCGAGGGCACGCCCGTC
TACCTGCACCCGAGCTCGGCGCTGTTCGGCAAGCACGCCGAATGGGTCATCTATCATACCCTGGTTCTGACGGAC
AAGGAGTACATGCACTGTACCACCAGTATCGAGCCCAAGTGGCTGGTCGAGGCGGCTCCGACATTCTTCAAGGTG
GCCCCGTCGGATAGGCTGAGCAAGCGGAAGCAGGCCGAGCGGATCCAGCCACTGTATAATCGGTTTGCTGGCGAG
GACGACTGGCGTTTGAGCGCGCAGCGGCGCGGCGGCAGGGGCGGCGGTGGCAGCACTTGGGGTTGA
Gene >Ophio5|7318
ATGGACGAGGTAACGAACCTCGAGTATCTCTCGCTCGTCTCAAAGGTCGTTTCCGAGCTTCAAAATCACGTGGGA
ATTAGCGACAAGAAACTCGCCGAGTTTCTCATCTTCCACCGCGCCGAAAAGAGCAGCTCCATCGAGGACTTTCGG
AAATGGCTCAACACCATCAACAACCCCTTCCCCGAGAGCTTCGTCAACAGTCTAGACCGCCTGGTTTTGGCGCTC
CATCCCAAGCTCAATAAGAACGGCGAGAATGCTCGACCCTCGCGCACACTCGAGGACAAGGAGAAGACGTTCAGC
GGACTCGCTCTGCCGGACCAGCAGCCACAGACTGACGAGAGAGGCGGCGGCGACGCCATCGATGATACACTGGCG
CTTTTGGAGGGTCTGGAGAACAGGGCCTCGGGGTACTCATCCAAGAGGCGCAGCCAGAGTCCCAAGGATGTGGAT
AGGCGGAGGAGGCGAAGCCGGAGTCCCAAAGATGCGGATAGGCGGAGGAGGCGAGACAGGTCCCGCTCAACAGAT
CGGCGCAAGAGAGGCATTCGCGTTCCTGACGATGAAGACTGGCGAGGCGACGACTATCGCGAATCGCGAAAGGGT
AGACGCGGCAGCAGGCGCTTCAACGACAATGAGAGCAACGCCCGACTCGACAGAGCGTTGGAACCCGAGATCGAC
GAGGTGCCTCAACTGAACAAGATTTATAAGGGTCATGTCACTGGAATCACGAACTTTGGCGCCTTTGTCAACCTG
CATAACGTTCGTGGCAAGGTCGACGGCCTTGTTCACGTCTCTCGTCTTTCGGCCGGTCAGCGCGTCAACCATCCC
TCCGACCTTGTCTCAAAGGGACAGCATGTGTTCGTCAAGCTGGTCAGTATCGAGGGCTCCAAAATCGGCCTTTCG
ATGAAGGATGTGGAACAAGATACAGGCATAGATCTTGAGCCTGAGTCACGGTTTTCCACCGGTGCCAATATGGAG
GCCCTAGGCGGCGGCAACAGGCGAGGCTTTGGAGGAGAGGCCTCCGTGATGCCGCCCGATGGCATTGGAGTTCCC
CTTGCGCGCCACAGGAAGAGGATGACGTCGCCTGAGAGGTGGGAAATTCGCCAGCTCATCGCGTCAGGCGTAGCC
AAAGCCTCCGACTTTCCCGAACTGGAAGAAGACTACAACGCGAGCCTGCGCGGCCATGGCGAGCTGGAGCTGGAA
GAGGACGTCGACATCGAGGTCAGGGACGAGGAACCGCCTTTCTTGGCTGGCCAGACCAAGCAGTCCCTGGAGCTC
TCGCCAATCCGAGTTGTGAAGGCGCCCGACGGGTCCATGAACCGAGCCGCCATGGCAGGCTCCGTCTTCGCCAAG
GAGAGGAAGGAGCTGAAGCGGCAGGAGGCCGAAACCAAGGAGGAGCCCAAGGAGAACCTGTCATCTCAATGGCTG
GACCCCATGGCGGATCCGGACAAGCGCAAGTTCGCGAGCGATATGAGGACCGCTCGCACGAACCCGAAGCCCGAG
GAGGCGCCCGAGTGGAAGAAGGCCGTCATCCCCAGGGGACAGCCTCTGGGGAAGCGCACCAATCTGAGCATGCAG
GAGCAGCGACGCCAGCTGCCCGTCTTCGCCTTCCGCAGCCAGCTCATACAGGCCATCAAGGACAACCAAATTCTC
ATAGTCGTGGGTGAGACCGGATCGGGCAAGACGACTCAGCTCACGCAATACCTGGCGGAGGCGGGCTTCGCAAGC
AAGGGGGGCATCATCGGGTGCACGCAGCCACGTCGAGTGGCGGCCATGTCGGTCGCCAAGCGCGTGGCCGAGGAG
GTCGGGTGCAAGACGGGGCAACAAGTCGGATATACCATCCGGTTCGAGGATTGCACGAGTCCAAAGACGATCATC
AAGTACATGACAGATGGCATGCTACAGCGGGAGATTCTCATGGACCCGGATATGGGGCGATATTCGGTCATTATG
CTCGACGAGGCACACGAGCGAACCATTTCGACTGATGTTCTATTTGCACTGCTCAAGAAGGCTCTCAAGCGGAGG
CCCGATCTCAAGGTCATCGTCACATCGGCCACGCTCGATGCCGATAAATTCTCAGCCTACTTTAACGAGTGTCCC
ATCTTTACCATCCCCGGGCGGACGTTTCCAGTCGAGATCCTCTACTCGAGGGAGCCCGAGTCAGACTATCTGGAC
GCGGCCCTCGTCACGGTGATGCAGATTCATCTCACGGAGCCCAAGGGTGACATTCTGCTCTTCCTCACGGGCCAG
GAGGAGATTGACACGGCGTGCGAGACGCTGTTTGACCGGATGAAGGCTCTGGGGCCTAGCGTGCCGGAACTCATC
ATTCTTCCCGTCTATTCTCAGCTTCCCACGGAAATGCAGAGCCGCATCTTTGAACCAGCTCCACCGGGAAGTCGC
AAGGTCGTCATCGCGACGAATATTGCCGAGACGTCCATCACCATCGACGAGATCTATTACGTTGTTGATCCGGGC
TTCGTCAAGCAGAACGCCTACGACCCGAAGCTCGGCATGGATTCGCTCGTCGTCACGCCAGTCTCACAGGCGCAG
GCGAACCAGAGGTCCGGGCGAGCCGGGCGCACGGGGCCCGGCAAGTGTTTCCGGCTCTACACAGAGGCCGCCTAT
CAGTCGGAGATGCTACCGACGACGATACCGGAGATACAGAGGCAGAATTTGGCGCATACCATCCTTATGCTCAAG
GCTATGGGCATCAACGATCTACTGCACTTTGACTTTATGGACCCGCCGCCTGTCAACTCGATGCTTACGGCGCTC
GAGGAGCTGTACGCGCTGAGTGCGCTCGACGATGAAGGTCTTTTGACGCGTCTCGGTCGCAAGATGGCCGACTTT
CCGATGGAGCCATCGCTGGCCAAGGTGCTGATTGCGGCCATCGACCACAACTGCTCGGACGAGATTCTGAGTCTC
GTCGCAATGCTCAATATGCCCAATGTTTTTTACCGGCCGAAAGAGAAGCAGCAGCAGGCGGATCAGAAGAAGTCC
AAGTTCCACGACCCTCACGGCGACCACCTGACGCTGCTCAACGTGTACAACGCCTGGAAGCACAGCGGCTTCTCC
AACCCGTGGTGCTTCGAAAACTTCATCCAGGCGCGGTCGATGCGGCGGGCTAAAGACGTGCGTGACCAGCTACTC
AAGATCATGAAACGCTATCGGATTCCCGTCGTGTCGTGTGGACGCGACACGCACAAGGTGCGACGAGCCCTGTGC
TGCGGCTTCTTCCGCAACGCGGCGCGTAAGGATCCTCACGAGGGCTACAAGACGCTCATCGAGGGCACGCCCGTC
TACCTGCACCCGAGCTCGGCGCTGTTCGGCAAGCACGCCGAATGGGTCATCTATCATACCCTGGTTCTGACGGAC
AAGGAGTACATGCACTGTACCACCAGTATCGAGCCCAAGTGGCTGGTCGAGGCGGCTCCGACATTCTTCAAGGTG
GCCCCGTCGGATAGGCTGAGCAAGCGGAAGCAGGCCGAGCGGATCCAGCCACTGTATAATCGGTTTGCTGGCGAG
GACGACTGGCGTTTGAGCGCGCAGCGGCGCGGCGGCAGGGGCGGCGGTGGCAGCACTTGGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail