Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7314
Gene name
Locationscaffold_7:53833..56907
Strand+
Gene length (bp)3074
Transcript length (bp)2898
Coding sequence length (bp)2895
Protein length (aa) 965

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12770 CHAT CHAT domain 2.5E-36 658 934

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6909 0.6415 0.0359 0.067 0.118 0.0109 0.075 0.0667 0.2553 0.0131

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup531
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4184
Ophiocordyceps camponoti-rufipedis Ophun1|5383
Ophiocordyceps kimflemingae Ophio5|7314 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3302
Ophiocordyceps subramaniannii Hirsu2|61
Ophiocordyceps subramaniannii Hirsu2|9455

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7314
MEHSADSKLNEPRVFSKTEFQQVDQDTPLRPYITFTTRPGKLQHLVVKIWSHDQGWCNPDLVDGNDAYANSWTWF
VLGLVEKTEDDYFNQSLYDFQRNVRASRSMHCHINEWKIGALDEADDDQDTNQLQEFLDSLAQAPSREVGIYPVA
QFAGWQNIVWKMEVHIMPCEDWQTDHHGDTTLRRSNKHFNSTRLVSPEEVLSLRRPFVIANAANATMRELEEAIE
ARRGDESEEAITETRHAINAIPLDHPDRPRWGALEDLQQAISITKQAITAIPTGHPLHSNRWKVVGNLGAQLEHL
YERTGEMTDLEEAIDLFKQSIAETPHDNPIISLRVRGLGDVLHLRFSRLGMIVDLEQAIGFGRLALATAGPERRF
RILAVRSLVRYLADYFERTGVTQALDEAMRLSVETGLSIPHDDIGQTIFLSSVAGHMDRYFRLTGEIQYQDLATD
FYETVLRSATAGIEARMYAGRQLLARPQVLQRGLRSYENAKLAVTWARTIPGSISTADKKHLLSNAVGIASDAAV
IALHYDQGPLAAATLLEAGRGILASNVFHLRSDEPELRAQHPELAETLESLQRRLDRPSLDDIVNPGDSLFLSSS
MDQRHLDSRRLQHVLDEIRTKDGFQSFRIGYTENNVRWGADCNTQPIRHRTDEIQSIKTLEWLWDDVVEPVLDAL
GFTSAPSADSWPNIWWIPTGLLSRFPLHAAGYHLDADGRTALDRIVSSYSSSVETIVRTRNRHLKVNMDASLVTV
SMKETPGLSPLIYTDDEIDAVRTLCNSGPLRLPVISPRPHRDEIISALKTCTIFHFAGHGNAEMDPLQSQLCLED
WRDRPLKVADLIETDLSSSFPFLAYLSACGTGKNPDRNSADESIHLTSIFQLAGFRHVIGTLWEVDDHLCVDMAN
MIYGSLGANGLNDASVSLALHRATRTLREEWLCEEISEATRRDVIVSNEEVSKMPLWVPYIHFGV
Coding >Ophio5|7314
ATGGAACACTCAGCGGACTCAAAGCTCAATGAGCCCAGGGTCTTCTCCAAGACAGAATTCCAGCAAGTTGACCAG
GACACTCCACTCCGTCCCTACATCACTTTCACGACAAGGCCAGGAAAGTTACAGCACTTGGTTGTCAAAATATGG
TCACATGATCAAGGATGGTGCAACCCTGACCTTGTAGATGGGAATGACGCCTACGCCAACTCTTGGACCTGGTTC
GTGCTCGGCCTAGTGGAAAAGACCGAGGACGATTACTTCAACCAGAGTTTGTATGATTTTCAGAGAAACGTCCGA
GCCTCACGCTCAATGCACTGCCACATCAACGAATGGAAGATTGGCGCCCTAGATGAAGCAGACGACGATCAAGAC
ACAAATCAACTGCAAGAATTCCTGGATTCTTTAGCGCAGGCTCCGAGTCGAGAAGTCGGAATCTACCCCGTGGCC
CAATTCGCTGGCTGGCAGAATATTGTTTGGAAGATGGAGGTTCATATCATGCCCTGTGAGGACTGGCAAACCGAC
CATCATGGCGATACAACTTTACGACGAAGCAACAAACATTTCAACTCGACAAGGTTGGTTAGTCCTGAAGAAGTC
TTAAGCCTCCGAAGACCATTTGTTATCGCCAATGCCGCCAACGCGACGATGCGGGAACTAGAAGAGGCCATCGAA
GCCAGACGAGGCGATGAATCAGAAGAAGCCATAACAGAGACCAGACACGCCATTAATGCGATTCCTCTCGACCAT
CCGGATCGACCGCGGTGGGGTGCCTTGGAGGATCTGCAACAGGCCATCAGTATCACCAAACAAGCCATCACTGCT
ATTCCTACCGGCCACCCGTTGCACTCGAATCGATGGAAAGTCGTGGGAAATCTTGGAGCTCAGCTGGAGCATCTT
TATGAACGAACGGGTGAGATGACGGACCTGGAAGAAGCCATCGACCTGTTTAAACAATCCATCGCCGAGACTCCC
CACGACAACCCCATCATATCGCTAAGAGTGCGCGGTCTTGGAGATGTCCTTCATCTGCGTTTCTCCCGCCTCGGC
ATGATAGTGGACCTGGAACAGGCCATTGGCTTCGGCAGGCTAGCCCTCGCGACAGCTGGGCCGGAAAGACGGTTT
CGAATCCTTGCCGTGAGGTCCCTGGTGAGATATTTGGCCGACTATTTCGAGCGAACGGGTGTCACCCAGGCCCTA
GATGAAGCCATGAGGCTCAGCGTGGAAACTGGCCTGTCGATCCCACATGACGATATTGGTCAAACGATTTTCCTC
AGCAGCGTTGCGGGCCATATGGACAGATACTTTCGTCTTACCGGTGAGATACAATACCAGGATCTGGCGACCGAC
TTTTACGAAACCGTCCTGCGATCCGCAACTGCTGGTATAGAGGCCCGTATGTACGCTGGCCGTCAGCTCCTCGCC
AGGCCCCAAGTCCTCCAGCGGGGTCTTCGGTCGTACGAGAATGCCAAGCTGGCTGTGACGTGGGCCCGTACAATT
CCTGGAAGCATTTCCACCGCGGACAAGAAGCATCTGCTCTCGAATGCCGTCGGCATCGCGTCTGACGCTGCCGTC
ATTGCTCTACACTATGATCAAGGTCCACTGGCTGCCGCAACCCTACTGGAGGCAGGTCGTGGGATTCTCGCCTCC
AATGTTTTCCACCTACGCTCTGATGAGCCGGAGCTGCGGGCTCAACACCCAGAGCTAGCCGAGACTCTCGAGTCT
CTTCAGCGTCGTCTCGATAGGCCGAGTCTGGATGATATTGTCAATCCTGGTGACTCCCTGTTCCTCTCGTCGTCT
ATGGATCAGCGCCACCTTGATTCCCGCCGGTTACAGCATGTACTGGACGAGATTCGCACCAAAGACGGATTTCAG
TCATTCCGTATCGGTTACACCGAAAACAACGTCCGCTGGGGGGCCGATTGTAATACTCAACCCATTCGGCATCGA
ACGGATGAAATACAGTCCATCAAAACTCTAGAATGGCTCTGGGACGATGTCGTTGAACCCGTGCTCGACGCACTC
GGCTTTACCAGTGCCCCTTCAGCAGATTCCTGGCCTAACATCTGGTGGATTCCGACAGGGCTACTTAGCAGGTTC
CCGCTTCACGCGGCGGGATATCATCTGGATGCCGACGGCAGAACGGCTCTCGATAGGATCGTGTCGTCCTACAGT
TCATCTGTAGAGACCATCGTTAGAACGCGCAACCGGCATTTAAAAGTGAACATGGACGCATCTCTCGTTACCGTT
TCGATGAAGGAAACACCAGGCTTGAGCCCTCTCATATACACAGACGACGAGATCGACGCCGTGCGGACACTATGC
AATTCAGGCCCCTTACGCCTGCCGGTCATCTCGCCGCGACCACATCGAGATGAGATAATCTCAGCACTAAAGACC
TGCACCATCTTTCATTTCGCCGGCCATGGTAATGCCGAGATGGATCCTCTTCAGAGCCAATTATGTCTCGAGGAC
TGGAGAGACCGTCCTCTGAAAGTAGCAGACCTCATCGAAACAGATCTGAGCTCAAGCTTTCCCTTCCTCGCCTAT
CTTTCAGCTTGCGGCACGGGCAAAAACCCGGATCGCAATTCAGCAGACGAGAGCATCCATCTCACTAGTATTTTC
CAACTTGCAGGGTTTCGACACGTTATTGGAACTCTTTGGGAGGTCGATGACCATCTATGTGTCGACATGGCCAAC
ATGATTTACGGCTCACTAGGCGCCAACGGACTCAATGACGCGTCTGTTAGCCTGGCTCTGCATCGGGCTACTCGC
ACACTTCGAGAGGAATGGCTGTGCGAGGAGATATCAGAGGCCACGAGACGAGACGTGATAGTGAGCAACGAAGAA
GTGTCCAAGATGCCGTTGTGGGTTCCTTACATTCATTTTGGAGTT
Transcript >Ophio5|7314
ATGGAACACTCAGCGGACTCAAAGCTCAATGAGCCCAGGGTCTTCTCCAAGACAGAATTCCAGCAAGTTGACCAG
GACACTCCACTCCGTCCCTACATCACTTTCACGACAAGGCCAGGAAAGTTACAGCACTTGGTTGTCAAAATATGG
TCACATGATCAAGGATGGTGCAACCCTGACCTTGTAGATGGGAATGACGCCTACGCCAACTCTTGGACCTGGTTC
GTGCTCGGCCTAGTGGAAAAGACCGAGGACGATTACTTCAACCAGAGTTTGTATGATTTTCAGAGAAACGTCCGA
GCCTCACGCTCAATGCACTGCCACATCAACGAATGGAAGATTGGCGCCCTAGATGAAGCAGACGACGATCAAGAC
ACAAATCAACTGCAAGAATTCCTGGATTCTTTAGCGCAGGCTCCGAGTCGAGAAGTCGGAATCTACCCCGTGGCC
CAATTCGCTGGCTGGCAGAATATTGTTTGGAAGATGGAGGTTCATATCATGCCCTGTGAGGACTGGCAAACCGAC
CATCATGGCGATACAACTTTACGACGAAGCAACAAACATTTCAACTCGACAAGGTTGGTTAGTCCTGAAGAAGTC
TTAAGCCTCCGAAGACCATTTGTTATCGCCAATGCCGCCAACGCGACGATGCGGGAACTAGAAGAGGCCATCGAA
GCCAGACGAGGCGATGAATCAGAAGAAGCCATAACAGAGACCAGACACGCCATTAATGCGATTCCTCTCGACCAT
CCGGATCGACCGCGGTGGGGTGCCTTGGAGGATCTGCAACAGGCCATCAGTATCACCAAACAAGCCATCACTGCT
ATTCCTACCGGCCACCCGTTGCACTCGAATCGATGGAAAGTCGTGGGAAATCTTGGAGCTCAGCTGGAGCATCTT
TATGAACGAACGGGTGAGATGACGGACCTGGAAGAAGCCATCGACCTGTTTAAACAATCCATCGCCGAGACTCCC
CACGACAACCCCATCATATCGCTAAGAGTGCGCGGTCTTGGAGATGTCCTTCATCTGCGTTTCTCCCGCCTCGGC
ATGATAGTGGACCTGGAACAGGCCATTGGCTTCGGCAGGCTAGCCCTCGCGACAGCTGGGCCGGAAAGACGGTTT
CGAATCCTTGCCGTGAGGTCCCTGGTGAGATATTTGGCCGACTATTTCGAGCGAACGGGTGTCACCCAGGCCCTA
GATGAAGCCATGAGGCTCAGCGTGGAAACTGGCCTGTCGATCCCACATGACGATATTGGTCAAACGATTTTCCTC
AGCAGCGTTGCGGGCCATATGGACAGATACTTTCGTCTTACCGGTGAGATACAATACCAGGATCTGGCGACCGAC
TTTTACGAAACCGTCCTGCGATCCGCAACTGCTGGTATAGAGGCCCGTATGTACGCTGGCCGTCAGCTCCTCGCC
AGGCCCCAAGTCCTCCAGCGGGGTCTTCGGTCGTACGAGAATGCCAAGCTGGCTGTGACGTGGGCCCGTACAATT
CCTGGAAGCATTTCCACCGCGGACAAGAAGCATCTGCTCTCGAATGCCGTCGGCATCGCGTCTGACGCTGCCGTC
ATTGCTCTACACTATGATCAAGGTCCACTGGCTGCCGCAACCCTACTGGAGGCAGGTCGTGGGATTCTCGCCTCC
AATGTTTTCCACCTACGCTCTGATGAGCCGGAGCTGCGGGCTCAACACCCAGAGCTAGCCGAGACTCTCGAGTCT
CTTCAGCGTCGTCTCGATAGGCCGAGTCTGGATGATATTGTCAATCCTGGTGACTCCCTGTTCCTCTCGTCGTCT
ATGGATCAGCGCCACCTTGATTCCCGCCGGTTACAGCATGTACTGGACGAGATTCGCACCAAAGACGGATTTCAG
TCATTCCGTATCGGTTACACCGAAAACAACGTCCGCTGGGGGGCCGATTGTAATACTCAACCCATTCGGCATCGA
ACGGATGAAATACAGTCCATCAAAACTCTAGAATGGCTCTGGGACGATGTCGTTGAACCCGTGCTCGACGCACTC
GGCTTTACCAGTGCCCCTTCAGCAGATTCCTGGCCTAACATCTGGTGGATTCCGACAGGGCTACTTAGCAGGTTC
CCGCTTCACGCGGCGGGATATCATCTGGATGCCGACGGCAGAACGGCTCTCGATAGGATCGTGTCGTCCTACAGT
TCATCTGTAGAGACCATCGTTAGAACGCGCAACCGGCATTTAAAAGTGAACATGGACGCATCTCTCGTTACCGTT
TCGATGAAGGAAACACCAGGCTTGAGCCCTCTCATATACACAGACGACGAGATCGACGCCGTGCGGACACTATGC
AATTCAGGCCCCTTACGCCTGCCGGTCATCTCGCCGCGACCACATCGAGATGAGATAATCTCAGCACTAAAGACC
TGCACCATCTTTCATTTCGCCGGCCATGGTAATGCCGAGATGGATCCTCTTCAGAGCCAATTATGTCTCGAGGAC
TGGAGAGACCGTCCTCTGAAAGTAGCAGACCTCATCGAAACAGATCTGAGCTCAAGCTTTCCCTTCCTCGCCTAT
CTTTCAGCTTGCGGCACGGGCAAAAACCCGGATCGCAATTCAGCAGACGAGAGCATCCATCTCACTAGTATTTTC
CAACTTGCAGGGTTTCGACACGTTATTGGAACTCTTTGGGAGGTCGATGACCATCTATGTGTCGACATGGCCAAC
ATGATTTACGGCTCACTAGGCGCCAACGGACTCAATGACGCGTCTGTTAGCCTGGCTCTGCATCGGGCTACTCGC
ACACTTCGAGAGGAATGGCTGTGCGAGGAGATATCAGAGGCCACGAGACGAGACGTGATAGTGAGCAACGAAGAA
GTGTCCAAGATGCCGTTGTGGGTTCCTTACATTCATTTTGGAGTTTAG
Gene >Ophio5|7314
ATGGAACACTCAGCGGACTCAAAGCTCAATGAGCCCAGGGTCTTCTCCAAGACAGAATTCCAGCAAGTTGACCAG
GACACTCCACTCCGTCCCTACATCACTTTCACGACAAGGCCAGGAAAGTTACAGCACTTGGTTGTCAAAATATGG
TCACATGATCAAGGTAACTCCAAACATTTGAGGCAAAGACACAGAAGCTAATCACGCTACAGGATGGTGCAACCC
TGACCTTGTAGATGGGAATGACGCCTACGCCAACTCTTGGACCTGGTTCGTGCTCGGCCTAGTGGAAAAGACCGA
GGACGATTACTTCAACCAGAGTTTGTATGATTTTCAGAGAAACGTCCGAGCCTCACGCTCAATGCACTGCCACAT
CAACGAATGGAAGATTGGCGCCCTAGATGAAGCAGACGACGATCAAGACACAAATCAACTGCAAGAATTCCTGGA
TTCTTTAGCGCAGGCTCCGAGTCGAGAAGTCGGAATCTACCCCGTGGCCCAATTCGCTGGCTGGCAGAATATTGT
TTGGAAGATGGAGGTTCATATCATGCCCTGTGAGGACTGGCAAACCGACCATCATGGCGATACAACTTTACGACG
AAGCAACAAACATTTCAACTCGACAAGGTTGGTTAGTCCTGAAGAAGTCTTAAGCCTCCGAAGACCATTTGTTAT
CGCCAATGCCGCCAACGCGACGATGCGGGAACTAGAAGAGGCCATCGAAGCCAGACGAGGCGATGAATCAGAAGA
AGCCATAACAGAGACCAGACACGCCATTAATGCGATTCCTCTCGACCATCCGGATCGACCGCGGTGGTAGATTGA
TTTCTCAAACGCCCTAGCAGTTCGCTACCTTGTCAGGGGTGCCTTGGAGGATCTGCAACAGGCCATCAGTATCAC
CAAACAAGCCATCACTGCTATTCCTACCGGCCACCCGTTGCACTCGAATCGATGGAAAGTCGTGGGAAATCTTGG
AGCTCAGCTGGAGCATCTTTATGAACGAACGGGTGAGATGACGGACCTGGAAGAAGCCATCGACCTGTTTAAACA
ATCCATCGCCGAGACTCCCCACGACAACCCCATCATATCGCTAAGAGTGCGCGGTCTTGGAGATGTCCTTCATCT
GCGTTTCTCCCGCCTCGGCATGATAGTGGACCTGGAACAGGCCATTGGCTTCGGCAGGCTAGCCCTCGCGACAGC
TGGGCCGGAAAGACGGTTTCGAATCCTTGCCGTGAGGTCCCTGGTGAGATATTTGGCCGACTATTTCGAGCGAAC
GGGTGTCACCCAGGCCCTAGATGAAGCCATGAGGCTCAGCGTGGAAACTGGCCTGTCGATCCCACATGACGATAT
TGGTCAAACGATTTTCCTCAGCAGCGTTGCGGGCCATATGGACAGATACTTTCGTCTTACCGGTGAGATACAATA
CCAGGATCTGGCGACCGACTTTTACGAAACCGTCCTGCGATCCGCAACTGCTGGTATAGAGGCCCGTATGTACGC
TGGCCGTCAGCTCCTCGCCAGGCCCCAAGTCCTCCAGCGGGGTCTTCGGTCGTACGAGAATGCCAAGCTGGCTGT
GACGTGGGCCCGTACAATTCCTGGAAGCATTTCCACCGCGGACAAGAAGCATCTGCTCTCGAATGCCGTCGGCAT
CGCGTCTGACGCTGCCGTCATTGCTCTACACTATGATCAAGGTCCACTGGCTGCCGCAACCCTACTGGAGGCAGG
TCGTGGGATTCTCGCCTCCAATGTTTTCCACCTACGCTCTGATGAGCCGGAGCTGCGGGCTCAACACCCAGAGCT
AGCCGAGACTCTCGAGTCTCTTCAGCGTCGTCTCGATAGGCCGAGTCTGGATGATATTGTCAATCCTGGTGACTC
CCTGTTCCTCTCGTCGTCTATGGATCAGCGCCACCTTGATTCCCGCCGGTTACAGCATGTACTGGACGAGATTCG
CACCAAAGACGGATTTCAGTCATTCCGTATCGGTTACACCGAAAACAACGTCCGCTGGGGGGCCGATTGTAATAC
TCAACGTGAGCGTGCATAGATGCGATGCGCTCATCATCCAAGAGTCTGGCATAAGAGCATTGCAGCTACCGAACC
TAACTCATGAAGCCATTCGGCATCGAACGGATGAAATACAGTCCATCAAAACTCTAGAATGGCTCTGGGACGATG
TCGTTGAACCCGTGCTCGACGCACTCGGCTTTACCAGTGCCCCTTCAGCAGATTCCTGGCCTAACATCTGGTGGA
TTCCGACAGGGCTACTTAGCAGGTTCCCGCTTCACGCGGCGGGATATCATCTGGATGCCGACGGCAGAACGGCTC
TCGATAGGATCGTGTCGTCCTACAGTTCATCTGTAGAGACCATCGTTAGAACGCGCAACCGGCATTTAAAAGTGA
ACATGGACGCATCTCTCGTTACCGTTTCGATGAAGGAAACACCAGGCTTGAGCCCTCTCATATACACAGACGACG
AGATCGACGCCGTGCGGACACTATGCAATTCAGGCCCCTTACGCCTGCCGGTCATCTCGCCGCGACCACATCGAG
ATGAGATAATCTCAGCACTAAAGACCTGCACCATCTTTCATTTCGCCGGCCATGGTAATGCCGAGATGGATCCTC
TTCAGAGCCAATTATGTCTCGAGGACTGGAGAGACCGTCCTCTGAAAGTAGCAGACCTCATCGAAACAGATCTGA
GCTCAAGCTTTCCCTTCCTCGCCTATCTTTCAGCTTGCGGCACGGGCAAAAACCCGGATCGCAATTCAGCAGACG
AGAGCATCCATCTCACTAGTATTTTCCAACTTGCAGGGTTTCGACACGTTATTGGAACTCTTTGGGAGGTCGATG
ACCATCTATGTGTCGACATGGCCAACATGATTTACGGCTCACTAGGCGCCAACGGACTCAATGACGCGTCTGTTA
GCCTGGCTCTGCATCGGGCTACTCGCACACTTCGAGAGGAATGGCTGTGCGAGGAGATATCAGAGGCCACGAGAC
GAGACGTGATAGTGAGCAACGAAGAAGTGTCCAAGATGCCGTTGTGGGTTCCTTACATTCATTTTGGAGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail