Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7312
Gene name
Locationscaffold_7:48547..49138
Strand-
Gene length (bp)591
Transcript length (bp)591
Coding sequence length (bp)588
Protein length (aa) 196

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.2369 0.2347 0.8558 0.2311 0.3032 0.1134 0.0148 0.2515 0.0869 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup171
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2453
Ophiocordyceps australis 1348a (Ghana) OphauG2|5209
Ophiocordyceps australis 1348a (Ghana) OphauG2|6873
Ophiocordyceps australis map64 (Brazil) OphauB2|6831
Ophiocordyceps australis map64 (Brazil) OphauB2|7159
Ophiocordyceps kimflemingae Ophio5|5336
Ophiocordyceps kimflemingae Ophio5|7312 (this protein)
Ophiocordyceps subramaniannii Hirsu2|186
Ophiocordyceps subramaniannii Hirsu2|260
Ophiocordyceps subramaniannii Hirsu2|2751
Ophiocordyceps subramaniannii Hirsu2|9178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7312
MRGAIVPVVPQVCHFESQPCLWRNKNSHGDCRPYKPIEIEGNPYTQRVATTKFLTREELCNKDTDGVNPGKECCK
AYGGSCGPNHLDLWCQPSVPTNQTQEKTVKKMQKTAETCTYKGRTCQWYGTSPSCGGNEFYEGMWNSYNGRRRQL
IVTTREDSKWQICNRRDTWLTPNPGECCQKYGYGCLSGYKRLWCDE
Coding >Ophio5|7312
ATGCGGGGCGCTATTGTTCCAGTCGTGCCGCAAGTGTGCCATTTCGAAAGCCAGCCATGCCTATGGCGCAACAAA
AACTCTCACGGTGATTGCCGACCTTACAAACCCATAGAGATTGAAGGAAACCCGTATACTCAGCGTGTCGCCACC
ACCAAGTTCTTGACACGCGAGGAGCTCTGCAACAAGGATACAGACGGAGTCAACCCTGGCAAGGAATGCTGCAAA
GCCTATGGAGGCTCTTGTGGCCCCAACCATCTCGATCTCTGGTGCCAACCGTCAGTCCCGACAAACCAGACGCAG
GAAAAGACTGTCAAGAAGATGCAGAAGACAGCCGAAACTTGTACGTACAAAGGCAGAACGTGTCAGTGGTATGGA
ACATCTCCCAGTTGTGGCGGCAACGAATTCTACGAGGGCATGTGGAACAGTTATAATGGCAGAAGACGGCAGCTC
ATCGTCACAACAAGGGAGGATTCGAAGTGGCAAATCTGCAACCGCCGGGACACGTGGCTTACCCCGAATCCGGGC
GAATGCTGCCAGAAATATGGCTACGGCTGCCTGTCGGGATACAAGCGGCTGTGGTGCGATGAG
Transcript >Ophio5|7312
ATGCGGGGCGCTATTGTTCCAGTCGTGCCGCAAGTGTGCCATTTCGAAAGCCAGCCATGCCTATGGCGCAACAAA
AACTCTCACGGTGATTGCCGACCTTACAAACCCATAGAGATTGAAGGAAACCCGTATACTCAGCGTGTCGCCACC
ACCAAGTTCTTGACACGCGAGGAGCTCTGCAACAAGGATACAGACGGAGTCAACCCTGGCAAGGAATGCTGCAAA
GCCTATGGAGGCTCTTGTGGCCCCAACCATCTCGATCTCTGGTGCCAACCGTCAGTCCCGACAAACCAGACGCAG
GAAAAGACTGTCAAGAAGATGCAGAAGACAGCCGAAACTTGTACGTACAAAGGCAGAACGTGTCAGTGGTATGGA
ACATCTCCCAGTTGTGGCGGCAACGAATTCTACGAGGGCATGTGGAACAGTTATAATGGCAGAAGACGGCAGCTC
ATCGTCACAACAAGGGAGGATTCGAAGTGGCAAATCTGCAACCGCCGGGACACGTGGCTTACCCCGAATCCGGGC
GAATGCTGCCAGAAATATGGCTACGGCTGCCTGTCGGGATACAAGCGGCTGTGGTGCGATGAGTAG
Gene >Ophio5|7312
ATGCGGGGCGCTATTGTTCCAGTCGTGCCGCAAGTGTGCCATTTCGAAAGCCAGCCATGCCTATGGCGCAACAAA
AACTCTCACGGTGATTGCCGACCTTACAAACCCATAGAGATTGAAGGAAACCCGTATACTCAGCGTGTCGCCACC
ACCAAGTTCTTGACACGCGAGGAGCTCTGCAACAAGGATACAGACGGAGTCAACCCTGGCAAGGAATGCTGCAAA
GCCTATGGAGGCTCTTGTGGCCCCAACCATCTCGATCTCTGGTGCCAACCGTCAGTCCCGACAAACCAGACGCAG
GAAAAGACTGTCAAGAAGATGCAGAAGACAGCCGAAACTTGTACGTACAAAGGCAGAACGTGTCAGTGGTATGGA
ACATCTCCCAGTTGTGGCGGCAACGAATTCTACGAGGGCATGTGGAACAGTTATAATGGCAGAAGACGGCAGCTC
ATCGTCACAACAAGGGAGGATTCGAAGTGGCAAATCTGCAACCGCCGGGACACGTGGCTTACCCCGAATCCGGGC
GAATGCTGCCAGAAATATGGCTACGGCTGCCTGTCGGGATACAAGCGGCTGTGGTGCGATGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail