Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7307
Gene name
Locationscaffold_7:34611..35133
Strand-
Gene length (bp)522
Transcript length (bp)522
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.068 0.0819 0.7831 0.4107 0.0451 0.0028 0.1822 0.0696 0.0815 0.0039

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999355

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4587
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3198
Ophiocordyceps australis map64 (Brazil) OphauB2|546
Ophiocordyceps camponoti-floridani Ophcf2|06296
Ophiocordyceps camponoti-rufipedis Ophun1|2620
Ophiocordyceps kimflemingae Ophio5|7307 (this protein)
Ophiocordyceps subramaniannii Hirsu2|963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7307
MIFHLSLAFLLALVPPSCAEVNYLAAMPLLERRAHHNPLLPRQTGTAISGISQECLVAAESVLGSLPSPPPEVQS
AILKDPQTNPCDFTTPSSLTSEFSSYSSVLASWASSNENKLTACSALSSLGALTDCKTANEASATSTRSGNLAAA
RPTGVAVAACAVAAAGFAAAAAL
Coding >Ophio5|7307
ATGATCTTCCACCTTTCCCTCGCCTTCCTCCTGGCCCTCGTGCCGCCCTCCTGCGCCGAGGTAAATTACCTAGCC
GCCATGCCACTGCTCGAGCGAAGGGCCCATCACAACCCGTTACTCCCCCGTCAGACCGGCACCGCCATCAGCGGC
ATCTCGCAGGAGTGCCTCGTCGCCGCCGAGTCCGTCCTCGGATCCCTACCCTCGCCGCCGCCAGAGGTTCAATCA
GCCATTCTGAAGGATCCGCAGACGAACCCTTGCGACTTCACGACGCCTTCTAGCCTGACGAGCGAGTTCAGTTCC
TATAGCTCTGTGCTCGCCTCCTGGGCTTCGTCCAACGAGAATAAGCTCACGGCTTGCTCCGCCTTGTCTAGCCTT
GGTGCGCTCACAGACTGCAAAACGGCCAACGAGGCTTCCGCCACCAGCACCCGCTCGGGAAACTTGGCCGCCGCC
CGACCAACTGGCGTTGCTGTCGCCGCTTGCGCCGTTGCCGCCGCTGGGTTCGCCGCCGCCGCCGCGCTA
Transcript >Ophio5|7307
ATGATCTTCCACCTTTCCCTCGCCTTCCTCCTGGCCCTCGTGCCGCCCTCCTGCGCCGAGGTAAATTACCTAGCC
GCCATGCCACTGCTCGAGCGAAGGGCCCATCACAACCCGTTACTCCCCCGTCAGACCGGCACCGCCATCAGCGGC
ATCTCGCAGGAGTGCCTCGTCGCCGCCGAGTCCGTCCTCGGATCCCTACCCTCGCCGCCGCCAGAGGTTCAATCA
GCCATTCTGAAGGATCCGCAGACGAACCCTTGCGACTTCACGACGCCTTCTAGCCTGACGAGCGAGTTCAGTTCC
TATAGCTCTGTGCTCGCCTCCTGGGCTTCGTCCAACGAGAATAAGCTCACGGCTTGCTCCGCCTTGTCTAGCCTT
GGTGCGCTCACAGACTGCAAAACGGCCAACGAGGCTTCCGCCACCAGCACCCGCTCGGGAAACTTGGCCGCCGCC
CGACCAACTGGCGTTGCTGTCGCCGCTTGCGCCGTTGCCGCCGCTGGGTTCGCCGCCGCCGCCGCGCTATAG
Gene >Ophio5|7307
ATGATCTTCCACCTTTCCCTCGCCTTCCTCCTGGCCCTCGTGCCGCCCTCCTGCGCCGAGGTAAATTACCTAGCC
GCCATGCCACTGCTCGAGCGAAGGGCCCATCACAACCCGTTACTCCCCCGTCAGACCGGCACCGCCATCAGCGGC
ATCTCGCAGGAGTGCCTCGTCGCCGCCGAGTCCGTCCTCGGATCCCTACCCTCGCCGCCGCCAGAGGTTCAATCA
GCCATTCTGAAGGATCCGCAGACGAACCCTTGCGACTTCACGACGCCTTCTAGCCTGACGAGCGAGTTCAGTTCC
TATAGCTCTGTGCTCGCCTCCTGGGCTTCGTCCAACGAGAATAAGCTCACGGCTTGCTCCGCCTTGTCTAGCCTT
GGTGCGCTCACAGACTGCAAAACGGCCAACGAGGCTTCCGCCACCAGCACCCGCTCGGGAAACTTGGCCGCCGCC
CGACCAACTGGCGTTGCTGTCGCCGCTTGCGCCGTTGCCGCCGCTGGGTTCGCCGCCGCCGCCGCGCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail