Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|73
Gene name
Locationscaffold_10:19102..21058
Strand+
Gene length (bp)1956
Transcript length (bp)1884
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07093 SGT1 SGT1 protein 1.0E-79 29 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 24 613 3.0E-59
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 24 613 4.0E-58
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 13 430 1.0E-44
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 26 610 9.0E-41
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 60 328 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 24 613 3.0E-59
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 24 613 4.0E-58
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 13 430 1.0E-44
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 26 610 9.0E-41
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 60 328 5.0E-34
sp|Q54JR9|ECD_DICDI Protein ecdysoneless homolog OS=Dictyostelium discoideum GN=ecd PE=3 SV=1 49 328 3.0E-29
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 551 615 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SGT1

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|73
MPEEGQMKKDAEVANVDNQFSRRVLENSVEYWLFLLGGEKEDRAALEVIRQAAENLSQSLTKDYIWQRDHFQLEL
REDDGMRCLYGVTDYGDAIEDEWLIVYMLRCLTDAHENLWVRVADADGEFLLIEAANVLPDWLSPETDQNRAWIH
GGKLLIIPCTGDGTHEGQSQSISLPQALGFIRSRSLDLVHSPFVQEEAFYRLGKYPRHISDSTHCSLITIPRKLA
YVLHSLPKSVSPAVEYFYLRDPISMRPILSTSTPLAFPPEDLVTVSVRFSRVLFAQLRSQRFEPPPGWQQVTRNS
VSSANPYDKERSARAEMGMKLAIGFEILSAAAGQDKRKVVKQVEALVKELSEPGERLLPTDQDIQSWRDSHRDDD
ETWMDINYEDFERELDGKPNNTTEENSGFGDTRTETDLRKIVSRFEAFLNDETAGLDGAELDDPRDGDDDDDDDD
DDDDDEDSEFEDKVVGFDEQAFSSMMRTMLGLPVPDSSSAQAHAGRQTLARTGGGKANLQSQEDAEIQELSNQME
NELQNCGALKYDDATEQRLAAGDGGSVGKGHEIKRRGSMSDTIEEENNGEEVQIDYNLARNLLESFKSQAGLAGP
TGNVLGMMGLRLPRDEECEDGEDDQPG
Coding >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATC
GTCTACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTT
CTACTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCAC
GGCGGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCA
CAGGCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTAC
AGGCTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCT
TACGTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATG
AGGCCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGC
AGAGTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCT
GTGTCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTC
GAAATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTG
TCGGAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGAC
GAAACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAA
AATTCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAAC
GACGAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGAC
GACGACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATG
ATGCGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCG
CGGACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAA
AATGAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGG
AGCGTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAA
GAGGTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCA
ACGGGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAG
CCAGGA
Transcript >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATC
GTCTACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTT
CTACTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCAC
GGCGGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCA
CAGGCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTAC
AGGCTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCT
TACGTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATG
AGGCCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGC
AGAGTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCT
GTGTCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTC
GAAATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTG
TCGGAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGAC
GAAACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAA
AATTCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAAC
GACGAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGAC
GACGACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATG
ATGCGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCG
CGGACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAA
AATGAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGG
AGCGTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAA
GAGGTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCA
ACGGGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAG
CCAGGATGA
Gene >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGTGTGTCACTGCTATCTATTTGTCTCGGATTCTCCTCAAGCTTGCGCTGCGAGCTGACCATG
AGTTGAAAAGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATCGTC
TACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTTCTA
CTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCACGGC
GGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCACAG
GCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTACAGG
CTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCTTAC
GTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATGAGG
CCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGCAGA
GTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCTGTG
TCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTCGAA
ATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTGTCG
GAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGACGAA
ACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAAAAT
TCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAACGAC
GAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGACGAC
GACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATGATG
CGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCGCGG
ACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAAAAT
GAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGGAGC
GTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAAGAG
GTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCAACG
GGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAGCCA
GGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail