Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|73
Gene name
Locationscaffold_10:19102..21058
Strand+
Gene length (bp)1956
Transcript length (bp)1884
Coding sequence length (bp)1881
Protein length (aa) 627

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07093 SGT1 SGT1 protein 1.0E-79 29 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 24 613 3.0E-59
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 24 613 4.0E-58
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 13 430 1.0E-44
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 26 610 9.0E-41
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 60 328 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95905|ECD_HUMAN Protein ecdysoneless homolog OS=Homo sapiens GN=ECD PE=1 SV=1 24 613 3.0E-59
sp|Q9CS74|ECD_MOUSE Protein ecdysoneless homolog OS=Mus musculus GN=Ecd PE=1 SV=2 24 613 4.0E-58
sp|Q9US49|ECD_SCHPO Protein ecdysoneless homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt1 PE=3 SV=1 13 430 1.0E-44
sp|Q9W032|ECD_DROME Protein ecdysoneless OS=Drosophila melanogaster GN=ecd PE=1 SV=1 26 610 9.0E-41
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 60 328 5.0E-34
sp|Q54JR9|ECD_DICDI Protein ecdysoneless homolog OS=Dictyostelium discoideum GN=ecd PE=3 SV=1 49 328 3.0E-29
sp|Q9LSM5|ECD_ARATH Protein ecdysoneless homolog OS=Arabidopsis thaliana GN=At5g65490 PE=1 SV=1 551 615 7.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5965 0.7275 0.2314 0.0049 0.0906 0.0719 0.2564 0.0881 0.2927 0.2804

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
SGT1

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6411
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1520
Ophiocordyceps australis map64 (Brazil) OphauB2|5384
Ophiocordyceps camponoti-floridani Ophcf2|03243
Ophiocordyceps camponoti-rufipedis Ophun1|4867
Ophiocordyceps kimflemingae Ophio5|73 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|73
MPEEGQMKKDAEVANVDNQFSRRVLENSVEYWLFLLGGEKEDRAALEVIRQAAENLSQSLTKDYIWQRDHFQLEL
REDDGMRCLYGVTDYGDAIEDEWLIVYMLRCLTDAHENLWVRVADADGEFLLIEAANVLPDWLSPETDQNRAWIH
GGKLLIIPCTGDGTHEGQSQSISLPQALGFIRSRSLDLVHSPFVQEEAFYRLGKYPRHISDSTHCSLITIPRKLA
YVLHSLPKSVSPAVEYFYLRDPISMRPILSTSTPLAFPPEDLVTVSVRFSRVLFAQLRSQRFEPPPGWQQVTRNS
VSSANPYDKERSARAEMGMKLAIGFEILSAAAGQDKRKVVKQVEALVKELSEPGERLLPTDQDIQSWRDSHRDDD
ETWMDINYEDFERELDGKPNNTTEENSGFGDTRTETDLRKIVSRFEAFLNDETAGLDGAELDDPRDGDDDDDDDD
DDDDDEDSEFEDKVVGFDEQAFSSMMRTMLGLPVPDSSSAQAHAGRQTLARTGGGKANLQSQEDAEIQELSNQME
NELQNCGALKYDDATEQRLAAGDGGSVGKGHEIKRRGSMSDTIEEENNGEEVQIDYNLARNLLESFKSQAGLAGP
TGNVLGMMGLRLPRDEECEDGEDDQPG
Coding >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATC
GTCTACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTT
CTACTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCAC
GGCGGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCA
CAGGCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTAC
AGGCTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCT
TACGTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATG
AGGCCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGC
AGAGTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCT
GTGTCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTC
GAAATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTG
TCGGAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGAC
GAAACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAA
AATTCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAAC
GACGAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGAC
GACGACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATG
ATGCGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCG
CGGACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAA
AATGAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGG
AGCGTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAA
GAGGTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCA
ACGGGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAG
CCAGGA
Transcript >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATC
GTCTACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTT
CTACTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCAC
GGCGGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCA
CAGGCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTAC
AGGCTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCT
TACGTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATG
AGGCCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGC
AGAGTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCT
GTGTCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTC
GAAATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTG
TCGGAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGAC
GAAACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAA
AATTCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAAC
GACGAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGAC
GACGACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATG
ATGCGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCG
CGGACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAA
AATGAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGG
AGCGTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAA
GAGGTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCA
ACGGGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAG
CCAGGATGA
Gene >Ophio5|73
ATGCCTGAGGAGGGCCAAATGAAGAAAGATGCGGAAGTTGCAAATGTCGACAACCAGTTCTCGAGGCGGGTGCTC
GAGAATTCTGTTGAGTATTGGCTGTTTCTCCTGGGCGGTGAGAAGGAAGATAGGGCCGCTCTGGAGGTTATTCGT
CAAGCCGCCGAGAATCTCAGCCAAAGTCTAACCAAGGACTATATCTGGCAACGTGACCATTTTCAACTTGAATTG
AGAGAAGATGATGGTGTGTCACTGCTATCTATTTGTCTCGGATTCTCCTCAAGCTTGCGCTGCGAGCTGACCATG
AGTTGAAAAGGAATGCGTTGTCTTTACGGCGTGACGGACTATGGTGATGCCATTGAGGATGAGTGGCTCATCGTC
TACATGCTGCGGTGCCTGACTGATGCGCACGAGAACCTTTGGGTCCGCGTCGCCGATGCCGATGGCGAATTTCTA
CTCATAGAGGCTGCCAATGTGTTGCCCGACTGGTTAAGCCCCGAGACGGACCAGAACCGCGCTTGGATCCACGGC
GGCAAGCTGCTTATCATCCCGTGCACAGGCGATGGCACACATGAAGGGCAGTCTCAATCAATTTCTCTGCCACAG
GCGCTGGGTTTCATCCGATCGCGCTCTCTGGACCTGGTCCATTCCCCCTTCGTACAGGAAGAGGCCTTTTACAGG
CTGGGAAAATATCCGAGACACATCTCCGATTCTACACACTGCTCACTCATCACCATACCGAGAAAGCTCGCTTAC
GTCCTTCACTCACTTCCAAAATCCGTATCTCCGGCGGTGGAGTACTTCTACCTCAGAGACCCGATCTCTATGAGG
CCAATCTTGTCTACTTCCACGCCGCTTGCATTCCCACCTGAAGATCTTGTCACTGTGAGTGTACGATTTAGCAGA
GTCCTTTTTGCGCAACTCAGATCGCAACGCTTTGAGCCACCTCCTGGGTGGCAGCAAGTTACGCGAAATTCTGTG
TCCTCGGCGAATCCATACGATAAGGAGAGAAGTGCTAGGGCTGAAATGGGAATGAAGCTGGCAATCGGGTTCGAA
ATCCTTTCTGCAGCCGCAGGCCAGGACAAGAGAAAGGTCGTCAAGCAAGTGGAGGCCCTAGTCAAAGAATTGTCG
GAACCCGGAGAAAGATTGTTACCTACTGATCAAGATATACAATCGTGGCGGGATTCTCATCGCGATGACGACGAA
ACTTGGATGGACATCAACTATGAAGATTTTGAGCGCGAGTTGGACGGCAAACCTAACAACACTACGGAGGAAAAT
TCGGGCTTTGGCGATACTCGAACCGAGACGGATTTGAGAAAGATCGTGTCACGATTCGAGGCCTTTTTGAACGAC
GAAACTGCTGGTCTGGATGGCGCCGAACTTGACGACCCAAGGGACGGCGACGACGACGACGACGACGACGACGAC
GACGATGACGACGAAGATAGCGAGTTTGAGGACAAAGTGGTCGGTTTCGACGAACAAGCTTTTTCTTCGATGATG
CGCACCATGTTGGGGTTGCCAGTACCGGATTCGTCATCTGCCCAAGCCCATGCAGGACGGCAGACCTTGGCGCGG
ACTGGAGGAGGAAAGGCAAACCTTCAGTCTCAGGAGGATGCGGAGATTCAAGAGCTTTCGAACCAGATGGAAAAT
GAACTTCAAAACTGCGGAGCGCTCAAATATGACGATGCAACTGAACAACGACTGGCCGCAGGAGACGGCGGGAGC
GTCGGAAAGGGACATGAGATAAAGCGGCGCGGCTCGATGTCCGACACGATCGAGGAGGAAAACAACGGTGAAGAG
GTCCAGATCGATTACAACCTGGCACGTAACCTATTGGAGAGCTTCAAGAGCCAGGCGGGCTTGGCCGGGCCAACG
GGCAACGTCCTCGGCATGATGGGTCTTCGACTGCCCAGAGACGAGGAATGCGAAGACGGTGAAGACGACCAGCCA
GGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail