Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7297
Gene name
Locationscaffold_7:6187..7495
Strand-
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 6.1E-14 68 284
PF08659 KR KR domain 7.7E-06 70 170
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.6E-05 70 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 4 372 4.0E-85
sp|P53878|YNS1_YEAST Uncharacterized oxidoreductase YNL181W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL181W PE=1 SV=2 49 398 3.0E-60
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 36 368 4.0E-26
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 36 368 3.0E-23
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 63 380 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13822|YEE6_SCHPO Uncharacterized oxidoreductase C19A8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.06 PE=3 SV=1 4 372 4.0E-85
sp|P53878|YNS1_YEAST Uncharacterized oxidoreductase YNL181W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL181W PE=1 SV=2 49 398 3.0E-60
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 36 368 4.0E-26
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 36 368 3.0E-23
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 63 380 3.0E-20
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 65 368 8.0E-20
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 65 368 1.0E-19
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 64 364 6.0E-18
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 68 364 2.0E-17
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 67 368 7.0E-17
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 39 368 2.0E-15
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 63 369 1.0E-14
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 67 368 1.0E-14
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 49 368 6.0E-14
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 65 367 1.0E-13
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 39 368 2.0E-13
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 63 375 1.0E-12
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 63 369 2.0E-12
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 63 369 2.0E-12
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 58 370 9.0E-12
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 65 367 2.0E-11
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 65 248 5.0E-11
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 65 367 5.0E-11
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 65 248 7.0E-11
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 67 376 8.0E-11
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 65 369 1.0E-08
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 65 331 3.0E-08
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 65 364 8.0E-08
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 65 362 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7297
MPLTTAHFNTPKMPLPFIFHIVEHGPPDWLRENRWPIFYLSLALASLVALKRWTAGRSNVAERPLHGKVVLMTGG
TSGVGAQAARELAARGAQLVLLTRVPPSDPFLAEYVQDLRDATGNLLIYAEQVDLASLHSIRTFATKWIDNAPPR
RLDMIVLCAAALTPPGGQRCETEEGIEHTWMVNFIANFHLLAILSPAVKAQPFDRDVRIIMATCSSYIASPSLRE
AVSADNWSPSTAYARSKLALNVFGQAFQKHLDAYKRPDQLPMNARVIFVDPGFSRTPGMRTWLTRGSLSGLFLYL
ACYAVPWFLLKSPYKAAQSILHAAMDAELGRGAGGRLIKECADVDFARAEVRDEAVAKKLWEESDGLIERVEREQ
AKRRAAEKAKRKQRDEEEEEKRKMGEVESLVKSITKGKETQKKQRQKGTSKAKLKDETIP
Coding >Ophio5|7297
ATGCCCCTGACGACGGCCCATTTCAACACCCCGAAGATGCCACTCCCCTTCATCTTCCACATCGTCGAGCATGGC
CCTCCCGACTGGCTACGCGAAAATCGCTGGCCTATCTTCTACCTCTCCCTGGCTCTCGCCTCGCTCGTCGCCCTG
AAGCGCTGGACGGCCGGCCGATCCAACGTCGCCGAGCGACCTCTCCATGGCAAAGTGGTGCTCATGACGGGCGGC
ACGTCTGGCGTCGGCGCTCAAGCTGCGCGGGAACTGGCCGCTCGAGGTGCTCAGCTTGTTCTCCTGACGCGCGTG
CCGCCTTCGGATCCGTTCCTCGCCGAATATGTTCAGGATCTGAGAGATGCAACGGGCAATCTCCTCATCTACGCC
GAGCAAGTGGACCTTGCCAGCTTGCACAGCATTCGTACTTTTGCGACGAAGTGGATTGATAATGCGCCGCCGAGA
CGACTTGATATGATTGTTCTATGTGCTGCTGCTCTGACGCCGCCGGGCGGCCAGAGATGTGAGACGGAGGAGGGC
ATCGAGCATACGTGGATGGTCAACTTCATCGCCAATTTTCACCTACTGGCCATCCTGAGCCCCGCCGTCAAGGCT
CAGCCATTCGATCGTGACGTTCGCATCATAATGGCCACCTGCTCTTCCTACATTGCCTCGCCGTCGCTGCGGGAG
GCGGTATCCGCCGACAATTGGAGCCCCAGCACGGCCTATGCCCGCAGCAAGCTTGCCCTCAACGTCTTCGGACAA
GCCTTCCAGAAGCACCTCGACGCCTACAAACGACCGGACCAGCTCCCCATGAACGCCCGCGTCATCTTCGTCGAC
CCGGGCTTCAGCCGCACTCCGGGCATGCGCACATGGCTCACCCGGGGCTCGCTCTCCGGCCTTTTTCTCTATCTA
GCCTGTTACGCCGTGCCATGGTTTCTGCTCAAGTCTCCATACAAGGCGGCGCAGTCGATTCTGCACGCTGCCATG
GACGCCGAACTCGGCCGCGGCGCCGGCGGTAGACTCATCAAGGAGTGCGCCGATGTGGACTTTGCGCGGGCCGAA
GTCAGAGACGAGGCTGTTGCCAAGAAACTGTGGGAGGAGAGCGATGGGCTGATTGAGAGGGTCGAAAGGGAGCAG
GCGAAACGGAGGGCGGCAGAAAAGGCAAAGCGGAAGCAGCGGGACGAGGAAGAGGAGGAGAAGAGAAAGATGGGC
GAGGTCGAGTCGCTGGTCAAGTCTATTACAAAGGGCAAGGAGACGCAGAAGAAACAGCGGCAGAAGGGTACGTCA
AAAGCCAAGCTCAAAGACGAGACGATTCCC
Transcript >Ophio5|7297
ATGCCCCTGACGACGGCCCATTTCAACACCCCGAAGATGCCACTCCCCTTCATCTTCCACATCGTCGAGCATGGC
CCTCCCGACTGGCTACGCGAAAATCGCTGGCCTATCTTCTACCTCTCCCTGGCTCTCGCCTCGCTCGTCGCCCTG
AAGCGCTGGACGGCCGGCCGATCCAACGTCGCCGAGCGACCTCTCCATGGCAAAGTGGTGCTCATGACGGGCGGC
ACGTCTGGCGTCGGCGCTCAAGCTGCGCGGGAACTGGCCGCTCGAGGTGCTCAGCTTGTTCTCCTGACGCGCGTG
CCGCCTTCGGATCCGTTCCTCGCCGAATATGTTCAGGATCTGAGAGATGCAACGGGCAATCTCCTCATCTACGCC
GAGCAAGTGGACCTTGCCAGCTTGCACAGCATTCGTACTTTTGCGACGAAGTGGATTGATAATGCGCCGCCGAGA
CGACTTGATATGATTGTTCTATGTGCTGCTGCTCTGACGCCGCCGGGCGGCCAGAGATGTGAGACGGAGGAGGGC
ATCGAGCATACGTGGATGGTCAACTTCATCGCCAATTTTCACCTACTGGCCATCCTGAGCCCCGCCGTCAAGGCT
CAGCCATTCGATCGTGACGTTCGCATCATAATGGCCACCTGCTCTTCCTACATTGCCTCGCCGTCGCTGCGGGAG
GCGGTATCCGCCGACAATTGGAGCCCCAGCACGGCCTATGCCCGCAGCAAGCTTGCCCTCAACGTCTTCGGACAA
GCCTTCCAGAAGCACCTCGACGCCTACAAACGACCGGACCAGCTCCCCATGAACGCCCGCGTCATCTTCGTCGAC
CCGGGCTTCAGCCGCACTCCGGGCATGCGCACATGGCTCACCCGGGGCTCGCTCTCCGGCCTTTTTCTCTATCTA
GCCTGTTACGCCGTGCCATGGTTTCTGCTCAAGTCTCCATACAAGGCGGCGCAGTCGATTCTGCACGCTGCCATG
GACGCCGAACTCGGCCGCGGCGCCGGCGGTAGACTCATCAAGGAGTGCGCCGATGTGGACTTTGCGCGGGCCGAA
GTCAGAGACGAGGCTGTTGCCAAGAAACTGTGGGAGGAGAGCGATGGGCTGATTGAGAGGGTCGAAAGGGAGCAG
GCGAAACGGAGGGCGGCAGAAAAGGCAAAGCGGAAGCAGCGGGACGAGGAAGAGGAGGAGAAGAGAAAGATGGGC
GAGGTCGAGTCGCTGGTCAAGTCTATTACAAAGGGCAAGGAGACGCAGAAGAAACAGCGGCAGAAGGGTACGTCA
AAAGCCAAGCTCAAAGACGAGACGATTCCCTGA
Gene >Ophio5|7297
ATGCCCCTGACGACGGCCCATTTCAACACCCCGAAGATGCCACTCCCCTTCATCTTCCACATCGTCGAGCATGGC
CCTCCCGACTGGCTACGCGAAAATCGCTGGCCTATCTTCTACCTCTCCCTGGCTCTCGCCTCGCTCGTCGCCCTG
AAGCGCTGGACGGCCGGCCGATCCAACGTCGCCGAGCGACCTCTCCATGGCAAAGTGGTGCTCATGACGGGCGGC
ACGTCTGGCGTCGGCGCTCAAGCTGCGCGGGAACTGGCCGCTCGAGGTGCTCAGCTTGTTCTCCTGACGCGCGTG
CCGCCTTCGGATCCGTTCCTCGCCGAATATGTTCAGGATCTGAGAGATGCAACGGGCAATCTCCTCATCTACGCC
GAGCAAGTGGACCTTGCCAGCTTGCACAGCATTCGTACTTTTGCGACGAAGTGGATTGATAATGCGCCGCCGAGA
CGACTTGATATGATTGTTCTATGTGCTGCTGCTCTGACGCCGCCGGGCGGCCAGAGATGTGAGACGGAGGAGGGC
ATCGAGCATACGTGGATGGTCAACTTCATCGCCAATTTTCACCTACTGGCCATCCTGAGCCCCGCCGTCAAGGCT
CAGCCATTCGATCGTGACGTTCGCATCATAATGGCCACCTGCTCTTCCTACATTGCCTCGCCGTCGCTGCGGGAG
GCGGTATCCGCCGACAATTGGAGCCCCAGCACGGCCTATGCCCGCAGCAAGCTTGCCCTCAACGTCTTCGGACAA
GCCTTCCAGAAGCACCTCGACGCCTACAAACGACCGGACCAGCTCCCCATGAACGCCCGCGTCATCTTCGTCGAC
CCGGGCTTCAGCCGCACTCCGGGCATGCGCACATGGCTCACCCGGGGCTCGCTCTCCGGCCTTTTTCTCTATCTA
GCCTGTTACGCCGTGCCATGGTTTCTGCTCAAGTCTCCATACAAGGCGGCGCAGTCGATTCTGCACGCTGCCATG
GACGCCGAACTCGGCCGCGGCGCCGGCGGTAGACTCATCAAGGAGTGCGCCGATGTGGACTTTGCGCGGGCCGAA
GTCAGAGACGAGGCTGTTGCCAAGAAACTGTGGGAGGAGAGCGATGGGCTGATTGAGAGGGTCGAAAGGGAGCAG
GCGAAACGGAGGGCGGCAGAAAAGGCAAAGCGGAAGCAGCGGGACGAGGAAGAGGAGGAGAAGAGAAAGATGGGC
GAGGTCGAGTCGCTGGTCAAGTCTATTACAAAGGGCAAGGAGACGCAGAAGAAACAGCGGCAGAAGGGTACGTCA
AAAGCCAAGCTCAAAGACGAGACGATTCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail