Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7289
Gene name
Locationscaffold_697:7974..9424
Strand-
Gene length (bp)1450
Transcript length (bp)1029
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00170 bZIP_1 bZIP transcription factor 1.2E-07 147 203
PF03131 bZIP_Maf bZIP Maf transcription factor 1.6E-04 145 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X229|FCR3_CANAX Fluconazole resistance protein 3 OS=Candida albicans GN=FCR3 PE=3 SV=1 146 334 1.0E-20
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 133 212 3.0E-09
sp|P38749|YAP3_YEAST AP-1-like transcription factor YAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP3 PE=1 SV=1 139 334 3.0E-09
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 139 207 3.0E-08
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 143 202 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X229|FCR3_CANAX Fluconazole resistance protein 3 OS=Candida albicans GN=FCR3 PE=3 SV=1 146 334 1.0E-20
sp|Q01663|AP1_SCHPO AP-1-like transcription factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pap1 PE=1 SV=2 133 212 3.0E-09
sp|P38749|YAP3_YEAST AP-1-like transcription factor YAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP3 PE=1 SV=1 139 334 3.0E-09
sp|P19880|YAP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAP1 PE=1 SV=2 139 207 3.0E-08
sp|P56095|AP1_KLULA AP-1-like transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAP1 PE=3 SV=1 143 202 3.0E-07
sp|Q3SZZ2|XBP1_BOVIN X-box-binding protein 1 OS=Bos taurus GN=XBP1 PE=2 SV=1 106 207 5.0E-07
sp|Q5AJU7|YAP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=1 SV=1 143 209 9.0E-06
sp|Q9R1S4|XBP1_RAT X-box-binding protein 1 OS=Rattus norvegicus GN=Xbp1 PE=2 SV=1 148 207 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0003677 DNA binding Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:0010468 regulation of gene expression No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7289
MDFSAHFHQAPLLGGAQPYPSFLAMQPLATAVSQEFEATAAPDIFDAFPRSFEFASGYHQPQQPLQQHAFVDPPT
PPPSTVATTATAAAAAAALFGQQRQQLHRPVSSAPGSSGAHVLGLTAGPGLEEMIPVQKGSDEEDMLTPAQSRRK
AQNRAAQRAFRERKDKHVKDLEAKVANLEADQQKVNVENERLRRNLQEISTENELLRATTTTTTTTSTSTSTSTL
SATQLGSLSPEPLPQCGSSSSPSSEDFYSTVLETCQNKSPSRRVVMSDHGEPLLAAGAAWDLIISHPLYRTGLVD
VGHVSERLECLARCDGLGPVFGERSILAAIEQSVASGSDDLL
Coding >Ophio5|7289
ATGGATTTCTCGGCCCATTTCCATCAAGCGCCTCTTCTTGGTGGGGCCCAGCCTTATCCGTCCTTTCTGGCGATG
CAGCCGTTGGCGACGGCGGTATCGCAAGAGTTTGAAGCGACAGCGGCGCCGGACATTTTCGATGCTTTCCCTCGC
TCCTTTGAGTTTGCGTCGGGCTATCATCAGCCTCAGCAGCCGCTTCAGCAACATGCCTTTGTCGACCCCCCTACA
CCACCTCCCAGTACCGTCGCCACCACTGCTACTGCTGCTGCCGCTGCCGCTGCTCTCTTTGGTCAGCAGCGGCAG
CAGCTACATAGGCCGGTGTCGTCGGCTCCGGGAAGCAGTGGCGCCCATGTCCTTGGTTTGACTGCGGGGCCGGGC
TTGGAGGAGATGATTCCGGTGCAGAAGGGGAGTGACGAGGAGGACATGTTGACGCCAGCTCAGTCGAGGCGCAAG
GCTCAGAACCGTGCTGCCCAGCGAGCATTTCGAGAAAGAAAAGACAAACATGTCAAAGACCTCGAAGCCAAAGTC
GCCAACCTGGAAGCCGATCAACAAAAGGTCAACGTCGAGAACGAGCGTCTTCGTCGTAACCTACAAGAAATATCG
ACGGAAAACGAGCTTCTACGAGCCACCACCACCACCACCACCACCACCTCCACCTCCACCTCCACCTCCACCTTG
TCAGCCACCCAACTGGGCTCACTTTCGCCCGAGCCGCTACCGCAGTGTGGTAGTAGCAGCAGCCCGTCCTCGGAA
GACTTCTATTCGACCGTGCTGGAAACATGTCAGAACAAGTCCCCTTCTCGTCGTGTCGTCATGTCGGATCATGGT
GAGCCCTTGCTGGCTGCTGGCGCCGCTTGGGATCTTATCATTTCTCATCCTCTTTATCGTACTGGTCTCGTTGAT
GTTGGGCATGTCAGCGAGCGGCTCGAGTGCTTGGCTCGTTGTGATGGACTGGGCCCCGTCTTTGGGGAGAGGTCT
ATACTGGCTGCTATCGAGCAGAGTGTTGCCAGTGGCTCGGATGACTTGTTA
Transcript >Ophio5|7289
ATGGATTTCTCGGCCCATTTCCATCAAGCGCCTCTTCTTGGTGGGGCCCAGCCTTATCCGTCCTTTCTGGCGATG
CAGCCGTTGGCGACGGCGGTATCGCAAGAGTTTGAAGCGACAGCGGCGCCGGACATTTTCGATGCTTTCCCTCGC
TCCTTTGAGTTTGCGTCGGGCTATCATCAGCCTCAGCAGCCGCTTCAGCAACATGCCTTTGTCGACCCCCCTACA
CCACCTCCCAGTACCGTCGCCACCACTGCTACTGCTGCTGCCGCTGCCGCTGCTCTCTTTGGTCAGCAGCGGCAG
CAGCTACATAGGCCGGTGTCGTCGGCTCCGGGAAGCAGTGGCGCCCATGTCCTTGGTTTGACTGCGGGGCCGGGC
TTGGAGGAGATGATTCCGGTGCAGAAGGGGAGTGACGAGGAGGACATGTTGACGCCAGCTCAGTCGAGGCGCAAG
GCTCAGAACCGTGCTGCCCAGCGAGCATTTCGAGAAAGAAAAGACAAACATGTCAAAGACCTCGAAGCCAAAGTC
GCCAACCTGGAAGCCGATCAACAAAAGGTCAACGTCGAGAACGAGCGTCTTCGTCGTAACCTACAAGAAATATCG
ACGGAAAACGAGCTTCTACGAGCCACCACCACCACCACCACCACCACCTCCACCTCCACCTCCACCTCCACCTTG
TCAGCCACCCAACTGGGCTCACTTTCGCCCGAGCCGCTACCGCAGTGTGGTAGTAGCAGCAGCCCGTCCTCGGAA
GACTTCTATTCGACCGTGCTGGAAACATGTCAGAACAAGTCCCCTTCTCGTCGTGTCGTCATGTCGGATCATGGT
GAGCCCTTGCTGGCTGCTGGCGCCGCTTGGGATCTTATCATTTCTCATCCTCTTTATCGTACTGGTCTCGTTGAT
GTTGGGCATGTCAGCGAGCGGCTCGAGTGCTTGGCTCGTTGTGATGGACTGGGCCCCGTCTTTGGGGAGAGGTCT
ATACTGGCTGCTATCGAGCAGAGTGTTGCCAGTGGCTCGGATGACTTGTTATAG
Gene >Ophio5|7289
ATGGATTTCTCGGCCCATTTCCATCAAGCGCCTCTTCTTGGTGGGGCCCAGCCTTATCCGTCCTTTCTGGCGATG
CAGCCGTTGGCGACGGCGGTATCGCAAGAGTTTGAAGCGACAGCGGCGCCGGTCAGTTTTTTTTTTTTTTTTTTT
TTTTCGATCTTTCTATTTTCCTTCTTTTTTTTCGCTCGTTTTCCCTTCTAGTTTCTCCCTCCCCCCCCCCCCCGG
GCGCGCTCTTATGCTTTTGCTGCTTTCTTTTCTCTTGGGCCCCCACCCCCCCTGGACTAGCTTCCAGTCCGGGGG
AAGGGGATGGACATTTTCGGGTTGCAACAAGAAATTGAGGGAAAAAAAAAAAAGAAAATTGAAAAGAAAATCGAA
AAGAAAAAACAGCTAATTCGGGTTCTGGCTAGGACATTTTCGATGCTTTCCCTCGCTCCTTTGAGTTTGCGTCGG
GCTATCATCAGCCTCAGCAGCCGCTTCAGCAACATGCCTTTGTCGACCCCCCTACACCACCTCCCAGTACCGTCG
CCACCACTGCTACTGCTGCTGCCGCTGCCGCTGCTCTCTTTGGTCAGCAGCGGCAGCAGCTACATAGGCCGGTGT
CGTCGGCTCCGGGAAGCAGTGGCGCCCATGTCCTTGGTTTGACTGCGGGGCCGGGCTTGGAGGAGATGATTCCGG
TGCAGAAGGGGAGTGACGAGGAGGACATGTTGACGCCAGCTCAGTCGAGGCGCAAGGCTCAGAACCGTGCTGCGT
AGGGCTCCCTCTTCCTCCTCCTCTTCCTCCTCCTCTTCATCCTCCTCTTCCTCCTCCTCTTCATTCCTCTTGAAT
CTTCTCGCCCCCCTTTATCTTTGACTAACTATATATATACGACCCTTCCAACGTCCTTCACAGCCAGCGAGCATT
TCGAGAAAGAAAAGACAAACATGTCAAAGACCTCGAAGCCAAAGTCGCCAACCTGGAAGCCGATCAACAAAAGGT
CAACGTCGAGAACGAGCGTCTTCGTCGTAACCTACAAGAAATATCGACGGAAAACGAGCTTCTACGAGCCACCAC
CACCACCACCACCACCACCTCCACCTCCACCTCCACCTCCACCTTGTCAGCCACCCAACTGGGCTCACTTTCGCC
CGAGCCGCTACCGCAGTGTGGTAGTAGCAGCAGCCCGTCCTCGGAAGACTTCTATTCGACCGTGCTGGAAACATG
TCAGAACAAGTCCCCTTCTCGTCGTGTCGTCATGTCGGATCATGGTGAGCCCTTGCTGGCTGCTGGCGCCGCTTG
GGATCTTATCATTTCTCATCCTCTTTATCGTACTGGTCTCGTTGATGTTGGGCATGTCAGCGAGCGGCTCGAGTG
CTTGGCTCGTTGTGATGGACTGGGCCCCGTCTTTGGGGAGAGGTCTATACTGGCTGCTATCGAGCAGAGTGTTGC
CAGTGGCTCGGATGACTTGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail