Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7283
Gene name
Locationscaffold_696:764..3028
Strand+
Gene length (bp)2264
Transcript length (bp)2202
Coding sequence length (bp)2199
Protein length (aa) 733

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 4.0E-139 170 617
PF14558 TRP_N ML-like domain 1.1E-37 26 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 22 660 8.0E-42
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 11 617 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 9 590 2.0E-35
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 20 543 3.0E-32
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 26 589 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 22 660 8.0E-42
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 11 617 2.0E-36
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 9 590 2.0E-35
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 20 543 3.0E-32
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 26 589 6.0E-29
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 19 555 2.0E-23
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1241 0.111 0.2729 0.424 0.0841 0.0086 0.3877 0.4864 0.506 0.0035

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999729

Transmembrane Domains

Domain # Start End Length
1 341 363 22
2 394 416 22
3 420 442 22
4 481 503 22
5 507 529 22
6 536 558 22
7 573 595 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1291
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6719
Ophiocordyceps australis map64 (Brazil) OphauB2|3173
Ophiocordyceps camponoti-floridani Ophcf2|07162
Ophiocordyceps camponoti-rufipedis Ophun1|6183
Ophiocordyceps kimflemingae Ophio5|7283 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10591

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7283
MARFDAPPWRLLLVGLVASARAADILKTDGFSSCGSGDTIKVDKVDISYDRDQKKVVFDVAGSSLREQNVTAILD
VTAYGNSVYQNSFNPCDSNTFVQRLCPVPKGSFAAQGTHEIPDQFASMIPEIAFKVPDISAQATLQLKSLEGDRV
ACIRSQVSNGKTANTRAARYMAAGVVGVSLAVSGASSASTLVSGAAAGGAGGLVAPSPSFAEAFGWFQGMAMNGM
FSVNYPPVYRSFSSNFAFSAFLVPWVGIESSIDDFRRKTGGNLTEDNVDFLRNATLVYPDGSTTSPNQGLLKFKR
AVDDFAALVPRDDTNQSSNLQHVVQGIQAYAARLSVPKSDIFMTALLVVAIIVAAIVVGILLGKVILEAWALFGS
FPESLAGFRKHYWGSIARTITSLILILYGIWVLYCIFQFTHGDTVAAKALAAVTLLIFTAVLAFFTWKIWSTARR
LKREGGDADGLYDDKKIWVKYSLFYEAYKKSYWWLFVPAIVYMFIKGATLAATDGNGRAQTVAQLIIEAFMLILL
LWSRPYERRSGNVVNIAIAVVRVLSVACILIFVEEFGIRQTTQTVAGVVLIVIQSTLTGVLTILIAWNAFNACCK
VNPHRKRRKDMEKMQRDCDALTPLDARNSLLLDPSRKDTKSSVLSLSLDHSEKSLTRSDSERYYPTTPAFESSYM
LPTPLAPGDATRSLVDSAAPMGVASHDSTSPPLERDYRGPLGPSYGYSSGGGGRGGWH
Coding >Ophio5|7283
ATGGCTCGGTTCGACGCTCCGCCGTGGCGATTGCTGCTCGTCGGCCTCGTCGCCTCGGCACGGGCCGCCGACATC
CTCAAGACGGACGGCTTCAGCTCTTGCGGCTCCGGCGACACCATCAAAGTGGACAAGGTCGACATCTCGTATGAC
CGAGACCAGAAGAAAGTCGTCTTCGACGTTGCCGGCTCCAGTCTACGAGAACAGAATGTCACGGCCATCCTCGAT
GTCACTGCTTACGGCAACTCCGTCTATCAGAATAGCTTCAACCCCTGCGACAGTAACACCTTCGTTCAGCGTCTG
TGTCCGGTCCCCAAAGGATCCTTCGCCGCTCAGGGCACCCACGAGATCCCCGATCAGTTCGCCTCCATGATACCG
GAAATCGCCTTTAAAGTCCCCGACATCTCCGCCCAGGCCACGCTGCAACTCAAAAGTCTCGAGGGCGATCGCGTC
GCCTGTATTCGCTCTCAGGTCTCCAATGGTAAGACGGCCAACACGCGCGCCGCTCGCTACATGGCGGCCGGAGTC
GTTGGCGTCTCCCTTGCCGTCTCTGGTGCCTCCTCGGCCTCGACCCTCGTCTCGGGCGCAGCAGCTGGCGGCGCC
GGCGGCCTCGTCGCCCCCAGTCCCAGCTTCGCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCCATGAATGGCATG
TTCTCCGTCAACTATCCACCCGTCTACCGCAGCTTCTCCTCCAACTTCGCCTTCTCCGCCTTCCTCGTCCCCTGG
GTCGGCATCGAGTCCTCAATCGACGACTTCCGCAGGAAGACCGGCGGCAATTTGACCGAGGACAACGTCGATTTT
CTCCGAAACGCCACCCTCGTCTATCCTGACGGCTCCACCACCAGCCCTAACCAGGGGCTACTCAAGTTCAAGCGC
GCCGTCGACGACTTCGCCGCCCTCGTCCCCCGCGACGACACCAATCAGTCGTCCAACCTCCAGCACGTCGTCCAG
GGCATTCAGGCCTACGCTGCTAGGCTGTCAGTCCCCAAGTCGGACATCTTCATGACGGCCCTGCTCGTCGTCGCC
ATCATTGTCGCCGCCATCGTCGTCGGCATCCTTCTCGGCAAGGTCATTCTCGAGGCCTGGGCCCTCTTCGGCAGC
TTCCCCGAGTCTCTCGCTGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGTACCATCACTTCCCTTATCCTC
ATTCTCTACGGCATCTGGGTTCTCTACTGCATATTTCAGTTCACTCACGGCGACACCGTCGCTGCCAAGGCCCTC
GCCGCCGTCACCCTCCTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAAATCTGGAGCACTGCCCGCCGT
CTCAAGCGCGAAGGTGGCGACGCCGACGGTCTCTACGACGACAAGAAGATCTGGGTCAAGTACTCGCTATTCTAC
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGGCCATTGTCTACATGTTCATCAAGGGCGCCACCCTG
GCCGCCACCGACGGCAACGGCAGGGCTCAGACGGTTGCTCAGCTCATCATCGAGGCCTTTATGCTGATCCTACTG
CTCTGGAGCCGTCCATACGAGCGCCGGTCCGGCAATGTCGTCAACATCGCCATCGCAGTCGTCCGTGTCCTGTCC
GTTGCCTGCATCCTCATCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACACAGACCGTCGCCGGCGTCGTCCTC
ATCGTCATTCAGTCCACCCTGACGGGCGTCCTCACCATCCTCATTGCCTGGAACGCCTTCAACGCCTGCTGCAAG
GTGAACCCTCACCGCAAGCGCAGGAAGGATATGGAGAAAATGCAGCGCGATTGCGATGCTCTCACGCCTCTCGAC
GCCCGCAACTCGCTGCTTCTCGATCCTTCGCGCAAAGATACAAAGTCATCTGTCCTCTCGCTGTCGCTCGACCAC
TCGGAGAAGTCGCTCACTCGCTCCGACTCGGAGCGATACTATCCCACCACGCCGGCCTTCGAATCCTCATACATG
CTCCCGACACCACTGGCGCCCGGCGACGCTACGCGGAGTCTCGTCGACTCCGCCGCTCCAATGGGTGTAGCTTCC
CACGATTCGACGTCACCGCCCCTCGAGCGCGACTACAGAGGGCCGCTGGGTCCGAGCTACGGCTACAGCAGTGGA
GGAGGAGGAAGAGGAGGCTGGCAC
Transcript >Ophio5|7283
ATGGCTCGGTTCGACGCTCCGCCGTGGCGATTGCTGCTCGTCGGCCTCGTCGCCTCGGCACGGGCCGCCGACATC
CTCAAGACGGACGGCTTCAGCTCTTGCGGCTCCGGCGACACCATCAAAGTGGACAAGGTCGACATCTCGTATGAC
CGAGACCAGAAGAAAGTCGTCTTCGACGTTGCCGGCTCCAGTCTACGAGAACAGAATGTCACGGCCATCCTCGAT
GTCACTGCTTACGGCAACTCCGTCTATCAGAATAGCTTCAACCCCTGCGACAGTAACACCTTCGTTCAGCGTCTG
TGTCCGGTCCCCAAAGGATCCTTCGCCGCTCAGGGCACCCACGAGATCCCCGATCAGTTCGCCTCCATGATACCG
GAAATCGCCTTTAAAGTCCCCGACATCTCCGCCCAGGCCACGCTGCAACTCAAAAGTCTCGAGGGCGATCGCGTC
GCCTGTATTCGCTCTCAGGTCTCCAATGGTAAGACGGCCAACACGCGCGCCGCTCGCTACATGGCGGCCGGAGTC
GTTGGCGTCTCCCTTGCCGTCTCTGGTGCCTCCTCGGCCTCGACCCTCGTCTCGGGCGCAGCAGCTGGCGGCGCC
GGCGGCCTCGTCGCCCCCAGTCCCAGCTTCGCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCCATGAATGGCATG
TTCTCCGTCAACTATCCACCCGTCTACCGCAGCTTCTCCTCCAACTTCGCCTTCTCCGCCTTCCTCGTCCCCTGG
GTCGGCATCGAGTCCTCAATCGACGACTTCCGCAGGAAGACCGGCGGCAATTTGACCGAGGACAACGTCGATTTT
CTCCGAAACGCCACCCTCGTCTATCCTGACGGCTCCACCACCAGCCCTAACCAGGGGCTACTCAAGTTCAAGCGC
GCCGTCGACGACTTCGCCGCCCTCGTCCCCCGCGACGACACCAATCAGTCGTCCAACCTCCAGCACGTCGTCCAG
GGCATTCAGGCCTACGCTGCTAGGCTGTCAGTCCCCAAGTCGGACATCTTCATGACGGCCCTGCTCGTCGTCGCC
ATCATTGTCGCCGCCATCGTCGTCGGCATCCTTCTCGGCAAGGTCATTCTCGAGGCCTGGGCCCTCTTCGGCAGC
TTCCCCGAGTCTCTCGCTGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGTACCATCACTTCCCTTATCCTC
ATTCTCTACGGCATCTGGGTTCTCTACTGCATATTTCAGTTCACTCACGGCGACACCGTCGCTGCCAAGGCCCTC
GCCGCCGTCACCCTCCTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAAATCTGGAGCACTGCCCGCCGT
CTCAAGCGCGAAGGTGGCGACGCCGACGGTCTCTACGACGACAAGAAGATCTGGGTCAAGTACTCGCTATTCTAC
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGGCCATTGTCTACATGTTCATCAAGGGCGCCACCCTG
GCCGCCACCGACGGCAACGGCAGGGCTCAGACGGTTGCTCAGCTCATCATCGAGGCCTTTATGCTGATCCTACTG
CTCTGGAGCCGTCCATACGAGCGCCGGTCCGGCAATGTCGTCAACATCGCCATCGCAGTCGTCCGTGTCCTGTCC
GTTGCCTGCATCCTCATCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACACAGACCGTCGCCGGCGTCGTCCTC
ATCGTCATTCAGTCCACCCTGACGGGCGTCCTCACCATCCTCATTGCCTGGAACGCCTTCAACGCCTGCTGCAAG
GTGAACCCTCACCGCAAGCGCAGGAAGGATATGGAGAAAATGCAGCGCGATTGCGATGCTCTCACGCCTCTCGAC
GCCCGCAACTCGCTGCTTCTCGATCCTTCGCGCAAAGATACAAAGTCATCTGTCCTCTCGCTGTCGCTCGACCAC
TCGGAGAAGTCGCTCACTCGCTCCGACTCGGAGCGATACTATCCCACCACGCCGGCCTTCGAATCCTCATACATG
CTCCCGACACCACTGGCGCCCGGCGACGCTACGCGGAGTCTCGTCGACTCCGCCGCTCCAATGGGTGTAGCTTCC
CACGATTCGACGTCACCGCCCCTCGAGCGCGACTACAGAGGGCCGCTGGGTCCGAGCTACGGCTACAGCAGTGGA
GGAGGAGGAAGAGGAGGCTGGCACTAG
Gene >Ophio5|7283
ATGGCTCGGTTCGACGCTCCGCCGTGGCGATTGCTGCTCGTCGGCCTCGTCGCCTCGGCACGGGCCGCCGACATC
CTCAAGACGGACGGCTTCAGCTCTTGCGGCTCCGGCGACACCATCAAAGTGGACAAGGTCGACATCTCGTATGAC
CGAGACCAGAAGAAAGTCGTCTTCGACGTTGCCGGCTCCAGTCTACGAGAACAGAATGTCACGGCCATCCTCGAT
GTCACTGCTTACGGCAACTCCGTCTATCAGAATAGCTTCAACCCCTGCGACAGTAACACCTTCGTTCAGCGTCTG
TGTCCGGTCCCCAAAGGATCCTTCGCCGCTCAGGGCACCCACGAGATCCCCGATCAGTTCGCCTCCATGATACCG
GAAATCGCCTTTAAAGTCCCCGACATCTCCGCCCAGGCCACGCTGCAACTCAAAAGTCTCGAGGGCGATCGCGTC
GCCTGTATTCGCTCTCAGGTCTCCAATGGTAAGACGGCCAACACGCGCGCCGCTCGCTACATGGCGGCCGGAGTC
GTTGGCGTCTCCCTTGCCGTCTCTGGTGCCTCCTCGGCCTCGACCCTCGTCTCGGGCGCAGCAGCTGGCGGCGCC
GGCGGCCTCGTCGCCCCCAGTCCCAGCTTCGCCGAGGCCTTTGGCTGGTTCCAGGGCATGGCCATGAATGGCATG
TTCTCCGTCAACTATCCACCCGTCTACCGCAGCTTCTCCTCCAACTTCGCCTTCTCCGCCTTCCTCGTCCCCTGG
GTCGGCATCGAGTCCTCAATCGACGACTTCCGCAGGAAGACCGGCGGCAATTTGACCGAGGACAACGTCGATTTT
CTCCGAAACGCCACCCTCGTCTATCCTGACGGCTCCACCACCAGCCCTAACCAGGGGCTACTCAAGTTCAAGCGC
GCCGTCGACGACTTCGCCGCCCTCGTCCCCCGCGACGACACCAATCAGTCGTCCAACCTCCAGCACGTCGTCCAG
GGCATTCAGGCCTACGCTGCTAGGCTGTCAGTCCCCAAGTCGGACATCTTCATGACGGCCCTGCTCGTCGTCGCC
ATCATTGTCGCCGCCATCGTCGTCGGCATCCTTCTCGGCAAGGTCATTCTCGAGGCCTGGGCCCTCTTCGGCAGC
TTCCCCGAGTCTCTCGCTGGCTTCCGCAAGCACTACTGGGGCTCCATCGCCCGTACCATCACTTCCCTTATCCTC
ATTCTCTACGGCATCTGGGTTCTCTACTGCATATTTCAGTTCACTCACGGCGACACCGTCGCTGCCAAGGCCCTC
GCCGCCGTCACCCTCCTCATCTTCACCGCCGTCCTCGCCTTCTTCACCTGGAAAATCTGGAGCACTGCCCGCCGT
CTCAAGCGCGAAGGTGGCGACGCCGACGGTCTCTACGACGACAAGAAGATCTGGGTCAAGTACTCGCTATTCTAC
GAGGCCTACAAGAAGAGCTACTGGTGGCTCTTCGTCCCGGCCATTGTCTACATGTTCATCAAGGGCGCCACCCTG
GCCGCCACCGACGGCAACGGCAGGGCTCAGACGGTTGCTCAGCTCATCATCGAGGCCTTTATGCTGATCCTACTG
CTCTGGAGCCGTCCATACGAGCGCCGGTCCGGCAATGTCGTCAACATCGCCATCGCAGTCGTCCGTGTCCTGTCC
GTTGCCTGCATCCTCATCTTCGTCGAGGAGTTTGGCATCCGTCAGACGACACAGACCGTCGCCGGCGTCGTCCTC
ATCGTCATTCAGTCCACCCTGACGGGCGTCCTCACCATCCTCATTGCCTGGAACGCCTTCAACGCCTGCTGCAAG
GTGAACCCTCACCGCAAGCGCAGGAAGGATATGGGTAAGCTGCCGGTGTCACCCCTGAGCCTCCTGGCCGATGCT
GATGCCTCCTCCTCACGACAGAGAAAATGCAGCGCGATTGCGATGCTCTCACGCCTCTCGACGCCCGCAACTCGC
TGCTTCTCGATCCTTCGCGCAAAGATACAAAGTCATCTGTCCTCTCGCTGTCGCTCGACCACTCGGAGAAGTCGC
TCACTCGCTCCGACTCGGAGCGATACTATCCCACCACGCCGGCCTTCGAATCCTCATACATGCTCCCGACACCAC
TGGCGCCCGGCGACGCTACGCGGAGTCTCGTCGACTCCGCCGCTCCAATGGGTGTAGCTTCCCACGATTCGACGT
CACCGCCCCTCGAGCGCGACTACAGAGGGCCGCTGGGTCCGAGCTACGGCTACAGCAGTGGAGGAGGAGGAAGAG
GAGGCTGGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail