Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7274
Gene name
Locationscaffold_693:9216..9489
Strand-
Gene length (bp)273
Transcript length (bp)273
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 17 79 7.0E-08
sp|C7J3A2|C7017_ORYSJ Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 39 79 1.0E-07
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 39 79 4.0E-07
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 40 81 2.0E-06
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 41 79 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 17 79 7.0E-08
sp|C7J3A2|C7017_ORYSJ Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 39 79 1.0E-07
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 39 79 4.0E-07
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 40 81 2.0E-06
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 41 79 2.0E-06
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 41 79 2.0E-06
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 17 76 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7274
MSSLRSSSFSAHVPPWLLAFLAVLGFAIWKISRIGHRPPKFPPGPPTLPVIGNLHQMPRTKMHRQYMKWADEYGY
VFRVAPNKQKQWLTD
Coding >Ophio5|7274
ATGTCCAGCCTTCGGTCCTCGTCGTTCAGTGCTCATGTTCCACCATGGCTCCTCGCTTTTCTCGCTGTTCTCGGC
TTTGCCATCTGGAAGATTTCTCGAATCGGCCACCGGCCACCCAAGTTTCCTCCTGGGCCACCGACACTGCCAGTC
ATCGGAAACCTCCATCAGATGCCAAGGACGAAGATGCATCGCCAGTACATGAAATGGGCCGACGAGTACGGGTAC
GTCTTTCGTGTCGCACCGAACAAGCAAAAGCAGTGGCTGACTGAC
Transcript >Ophio5|7274
ATGTCCAGCCTTCGGTCCTCGTCGTTCAGTGCTCATGTTCCACCATGGCTCCTCGCTTTTCTCGCTGTTCTCGGC
TTTGCCATCTGGAAGATTTCTCGAATCGGCCACCGGCCACCCAAGTTTCCTCCTGGGCCACCGACACTGCCAGTC
ATCGGAAACCTCCATCAGATGCCAAGGACGAAGATGCATCGCCAGTACATGAAATGGGCCGACGAGTACGGGTAC
GTCTTTCGTGTCGCACCGAACAAGCAAAAGCAGTGGCTGACTGACTGA
Gene >Ophio5|7274
ATGTCCAGCCTTCGGTCCTCGTCGTTCAGTGCTCATGTTCCACCATGGCTCCTCGCTTTTCTCGCTGTTCTCGGC
TTTGCCATCTGGAAGATTTCTCGAATCGGCCACCGGCCACCCAAGTTTCCTCCTGGGCCACCGACACTGCCAGTC
ATCGGAAACCTCCATCAGATGCCAAGGACGAAGATGCATCGCCAGTACATGAAATGGGCCGACGAGTACGGGTAC
GTCTTTCGTGTCGCACCGAACAAGCAAAAGCAGTGGCTGACTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail