Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7267
Gene name
Locationscaffold_692:7267..8078
Strand+
Gene length (bp)811
Transcript length (bp)573
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08212 Lipocalin_2 Lipocalin-like domain 1.4E-20 41 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51910|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=1 SV=1 29 187 2.0E-09
sp|P05090|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1 29 187 3.0E-09
sp|P51909|APOD_CAVPO Apolipoprotein D OS=Cavia porcellus GN=APOD PE=2 SV=1 29 103 6.0E-09
sp|P23593|APOD_RAT Apolipoprotein D OS=Rattus norvegicus GN=Apod PE=1 SV=1 29 187 2.0E-08
sp|P37153|APOD_RABIT Apolipoprotein D OS=Oryctolagus cuniculus GN=APOD PE=2 SV=1 29 187 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51910|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=1 SV=1 29 187 2.0E-09
sp|P05090|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1 29 187 3.0E-09
sp|P51909|APOD_CAVPO Apolipoprotein D OS=Cavia porcellus GN=APOD PE=2 SV=1 29 103 6.0E-09
sp|P23593|APOD_RAT Apolipoprotein D OS=Rattus norvegicus GN=Apod PE=1 SV=1 29 187 2.0E-08
sp|P37153|APOD_RABIT Apolipoprotein D OS=Oryctolagus cuniculus GN=APOD PE=2 SV=1 29 187 2.0E-08
sp|Q32KY0|APOD_BOVIN Apolipoprotein D OS=Bos taurus GN=APOD PE=2 SV=1 29 103 3.0E-08
sp|Q08790|BLC_VIBCH Outer membrane lipoprotein Blc OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=blc PE=3 SV=2 1 184 5.0E-08
sp|Q5URA7|YR877_MIMIV Putative lipocalin R877 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R877 PE=1 SV=1 36 153 2.0E-07
sp|Q8SPI0|APOD_MACFA Apolipoprotein D OS=Macaca fascicularis GN=APOD PE=2 SV=1 29 187 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7267
MRAQLIVSLSSLALASSAASPVAPASWDGKCFYPKASGSFELTSYLGRWYQVAGTKAPFTAGCKCIMADYALNKD
ETVQVNNSCETPKGDFRNIVGTATPSKLPYGSKGVFHVEFPGSKATDCPGPNYIVLDQKKDMAIVQTSNFTTLFL
LSRRQKPETKVLDAWIRRAASLGVKSGQVERIDQSNCKYT
Coding >Ophio5|7267
ATGCGCGCCCAACTCATCGTCAGCCTCTCCAGCCTGGCGCTCGCAAGTAGCGCCGCCAGCCCCGTCGCTCCGGCA
AGCTGGGACGGCAAATGCTTCTACCCCAAAGCTAGCGGCTCGTTCGAGCTGACGTCCTATCTCGGGCGCTGGTAC
CAGGTGGCTGGCACCAAGGCGCCCTTCACGGCCGGATGTAAATGCATCATGGCCGATTATGCCTTGAACAAGGAT
GAGACGGTGCAGGTCAACAATTCGTGCGAGACGCCCAAGGGGGACTTTAGAAACATCGTGGGGACGGCAACGCCA
TCGAAATTACCGTACGGCTCCAAAGGCGTTTTCCACGTCGAGTTCCCTGGCAGCAAAGCGACGGACTGTCCCGGC
CCAAACTATATCGTCCTAGACCAGAAGAAAGACATGGCGATTGTGCAGACTAGCAACTTTACGACTCTATTTCTC
CTCAGCAGGAGGCAGAAGCCGGAAACCAAAGTTCTTGATGCTTGGATTCGACGCGCGGCTTCTTTGGGCGTCAAG
TCCGGCCAAGTGGAAAGGATTGATCAGTCGAATTGTAAATACACT
Transcript >Ophio5|7267
ATGCGCGCCCAACTCATCGTCAGCCTCTCCAGCCTGGCGCTCGCAAGTAGCGCCGCCAGCCCCGTCGCTCCGGCA
AGCTGGGACGGCAAATGCTTCTACCCCAAAGCTAGCGGCTCGTTCGAGCTGACGTCCTATCTCGGGCGCTGGTAC
CAGGTGGCTGGCACCAAGGCGCCCTTCACGGCCGGATGTAAATGCATCATGGCCGATTATGCCTTGAACAAGGAT
GAGACGGTGCAGGTCAACAATTCGTGCGAGACGCCCAAGGGGGACTTTAGAAACATCGTGGGGACGGCAACGCCA
TCGAAATTACCGTACGGCTCCAAAGGCGTTTTCCACGTCGAGTTCCCTGGCAGCAAAGCGACGGACTGTCCCGGC
CCAAACTATATCGTCCTAGACCAGAAGAAAGACATGGCGATTGTGCAGACTAGCAACTTTACGACTCTATTTCTC
CTCAGCAGGAGGCAGAAGCCGGAAACCAAAGTTCTTGATGCTTGGATTCGACGCGCGGCTTCTTTGGGCGTCAAG
TCCGGCCAAGTGGAAAGGATTGATCAGTCGAATTGTAAATACACTTGA
Gene >Ophio5|7267
ATGCGCGCCCAACTCATCGTCAGCCTCTCCAGCCTGGCGCTCGCAAGTAGCGCCGCCAGCCCCGTCGCTCCGGCA
AGCTGGGACGGCAAATGCTTCTACCCCAAAGCTAGCGGCTCGTTCGAGCTGACGTCCTATCTCGGGCGCTGGTAC
CAGGTGGCTGGCACCAAGGCGCCCTTCACGGCCGGATGTAAATGCATCATGGCCGATTATGCCTTGAACGTGAGG
TCCCACGATACTTCCCAAAGATGACATGGAAAGGGGGGGGGGGAGAAAGGTTTTCTGACGGGCGACGGACTCTAG
AAGGATGAGACGGTGCAGGTCAACAATTCGTGCGAGACGCCCAAGGGGGACTTTAGAAACATCGTGGGGACGGCA
ACGCCATCGAAATTACCGTACGGCTCCAAAGGCGTTTTCCACGTCGAGTTCCCTGGCAGCAAAGCGACGGACTGT
CCCGGCCCAAACTATATCGTCCTAGGCAAGTGACCAACACAGGCCCTTCTCACGCCCTTGCATGTCCTTGCTGAC
GGGGGGTTTTTTTTTGGCCAATTTGCCAGACCAGAAGAAAGACATGGCGATTGTGCAGACTAGCAACTTTACGAC
TCTATTTCTCCTCAGCAGGAGGCAGAAGCCGGAAACCAAAGTTCTTGATGTCAGTTTTGTCTCTCTCCCCCTCTC
CCTCTCTTTGAATAACCCGAGGTGAAGGATATCTAACATGGGATCTGTACAGGCTTGGATTCGACGCGCGGCTTC
TTTGGGCGTCAAGTCCGGCCAAGTGGAAAGGATTGATCAGTCGAATTGTAAATACACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail