Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7266
Gene name
Locationscaffold_692:4468..6205
Strand+
Gene length (bp)1737
Transcript length (bp)1737
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.5E-39 64 447
PF00083 Sugar_tr Sugar (and other) transporter 1.1E-18 59 233
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 8.3E-06 91 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 59 577 1.0E-59
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 73 571 4.0E-43
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 59 574 7.0E-38
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 51 576 3.0E-34
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 51 576 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 59 577 1.0E-59
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 73 571 4.0E-43
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 59 574 7.0E-38
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 51 576 3.0E-34
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 51 576 3.0E-34
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 5 577 5.0E-33
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 24 550 7.0E-32
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 67 501 1.0E-31
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 5 577 2.0E-31
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 5 546 4.0E-31
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 69 576 5.0E-31
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 11 399 1.0E-30
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 67 524 9.0E-27
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 91 563 2.0E-26
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 66 407 1.0E-23
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 66 407 1.0E-23
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 65 496 8.0E-20
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 73 379 1.0E-19
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 69 386 1.0E-17
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 69 386 2.0E-17
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 67 384 4.0E-17
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 73 221 4.0E-16
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 66 379 4.0E-16
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 66 363 3.0E-15
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 67 388 1.0E-14
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 67 388 1.0E-14
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 67 388 1.0E-14
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 67 388 1.0E-14
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 67 388 1.0E-14
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 67 388 1.0E-14
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 67 388 1.0E-14
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 67 388 1.0E-14
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 66 344 5.0E-14
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 66 363 7.0E-14
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 66 370 1.0E-13
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 58 364 1.0E-13
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 58 364 1.0E-13
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 66 379 1.0E-13
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 68 344 1.0E-13
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 66 363 4.0E-13
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 146 524 5.0E-13
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 66 355 7.0E-13
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 66 363 1.0E-12
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 68 364 2.0E-12
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 66 355 3.0E-12
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 61 363 3.0E-12
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 66 363 5.0E-12
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 72 375 6.0E-12
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 67 212 7.0E-12
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 66 363 1.0E-11
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 66 363 1.0E-11
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 68 422 3.0E-11
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 68 422 3.0E-11
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 66 277 4.0E-11
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 48 387 4.0E-11
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 66 277 8.0E-11
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 66 277 9.0E-11
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 66 277 9.0E-11
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 66 277 1.0E-10
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 66 277 1.0E-10
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 66 277 1.0E-10
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 66 277 1.0E-10
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 68 379 1.0E-10
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 66 277 1.0E-10
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 66 277 2.0E-10
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 66 277 3.0E-10
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 5 519 4.0E-10
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 66 377 6.0E-10
sp|Q04602|VBA4_YEAST Vacuolar basic amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA4 PE=1 SV=1 40 232 7.0E-10
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 66 379 2.0E-09
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 66 379 2.0E-09
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 112 237 3.0E-09
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 95 405 4.0E-09
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 20 322 8.0E-09
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 59 497 1.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 66 442 1.0E-08
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 112 237 1.0E-08
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 95 337 1.0E-08
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 68 364 2.0E-08
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 112 237 2.0E-08
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 9 382 2.0E-08
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 9 457 4.0E-08
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 111 237 6.0E-08
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 112 237 7.0E-08
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 96 237 8.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 68 391 1.0E-07
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 58 354 3.0E-07
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 65 358 3.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 61 363 3.0E-07
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 58 354 4.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 95 370 5.0E-07
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 55 448 6.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 95 370 7.0E-07
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 68 449 7.0E-07
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 68 449 7.0E-07
sp|Q8NLB7|GENK_CORGL Gentisate transporter OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=genK PE=1 SV=2 42 250 9.0E-07
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 57 344 1.0E-06
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 63 374 2.0E-06
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 112 237 2.0E-06
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 61 363 2.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 95 380 2.0E-06
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 57 239 2.0E-06
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 61 363 3.0E-06
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 61 363 3.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 63 374 3.0E-06
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 111 249 3.0E-06
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 18 217 4.0E-06
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 114 395 4.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 91 388 4.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 91 388 4.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 63 374 4.0E-06
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 66 363 5.0E-06
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 3 248 5.0E-06
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 111 254 6.0E-06
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 61 363 7.0E-06
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 61 363 7.0E-06
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 61 363 7.0E-06
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 61 363 7.0E-06
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 61 363 7.0E-06
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 61 363 7.0E-06
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 61 363 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 93 115 22
3 122 144 22
4 148 170 22
5 182 204 22
6 214 236 22
7 249 271 22
8 277 299 22
9 320 342 22
10 352 374 22
11 381 403 22
12 413 435 22
13 473 495 22
14 544 566 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7266
MACPDDSNEIEQRPSVSSQTASCSETTRLLPKNGGGGDEEEEERTVIVKDISFTRLALIMSTAWSGVFLAALDST
IIATLSAPISSEFNSLSLFSWLATGYLISTAACQPISGRLTDIFGRGPGLIFCNVVFAVGNLICGLAMNQHVVIV
GRVVAGIGGGGLLSIATFLASDLVPLRQRGLVGAVGNLWFGTGCMLGGVLGGLLNDYTALGWRLAFLIQVPPSIL
SAIAVMLLVKVPPKQSDRSHLARIDFLGVFLTSSFLVLLVFGLNAGGNLTPWLHPLPITCLLLSLVLFFTFIWWE
SRARQPIIPVKLLLHRTVFCASLTGLLVAMLVNTAIFFVPLYLQILGETATSAGLRTLSSPVGMAMGALSSGYLM
RRTGKFVGLGIASELLLVVGASLLCLQSQHTPATLTTAAFFFIGGGYSAVLSVTQIACIAAVDHSQQAVVTSITC
KPGRVPSERERERESEPILTPRVAIVLARSLGGTVGITVVSAIYQNTLDARLWSRFGGEPDAAAIIGRLRDDIGQ
LRNVPASWRPGVVASFSEAFRFVWLTVLAWSLLALVCVSPIKQHKLHSSLDRR
Coding >Ophio5|7266
ATGGCTTGCCCCGACGACAGCAACGAGATAGAGCAGCGGCCATCCGTCAGCTCCCAGACGGCGTCATGCTCCGAG
ACGACAAGACTGCTGCCGAAGAATGGTGGCGGTGGCGACGAGGAGGAGGAGGAGAGAACGGTCATCGTCAAGGAC
ATTTCCTTTACCAGGCTGGCGCTTATCATGAGCACCGCTTGGTCCGGTGTGTTCCTCGCCGCTCTCGACTCGACC
ATCATCGCTACCCTATCGGCGCCTATATCTAGCGAGTTTAACTCGCTGAGTCTATTCTCCTGGCTCGCTACCGGC
TATCTAATATCCACGGCTGCCTGTCAACCGATATCTGGTCGTCTTACCGATATCTTTGGACGGGGCCCCGGCCTC
ATCTTCTGTAACGTCGTCTTCGCCGTCGGTAATCTCATCTGCGGCTTAGCTATGAACCAACACGTCGTCATTGTT
GGTCGCGTCGTTGCTGGCATCGGTGGCGGTGGTCTGTTAAGCATCGCCACCTTTCTCGCCTCCGATCTGGTCCCT
CTCCGGCAACGCGGACTCGTCGGCGCCGTCGGTAACCTCTGGTTCGGGACTGGGTGTATGCTTGGTGGCGTCTTG
GGCGGCTTGCTAAACGATTATACGGCCTTGGGCTGGCGGCTTGCCTTTCTTATCCAGGTCCCGCCCTCTATACTG
TCTGCTATAGCCGTCATGTTGCTGGTCAAGGTGCCGCCCAAGCAGTCAGATCGGTCGCACCTGGCGAGGATCGAC
TTTCTCGGTGTTTTCCTAACCTCGTCCTTTCTAGTCCTGCTTGTCTTTGGCCTAAACGCGGGAGGCAATCTGACT
CCATGGCTTCACCCCCTACCAATTACCTGTCTGCTGCTTTCTCTTGTACTCTTCTTCACCTTTATATGGTGGGAA
AGTAGGGCTCGACAGCCCATTATTCCCGTGAAACTGCTACTTCACCGCACCGTCTTTTGCGCTTCTCTCACCGGC
CTCCTCGTCGCCATGCTGGTCAACACGGCCATCTTCTTCGTCCCGCTCTATCTGCAGATTCTAGGCGAGACGGCA
ACGAGCGCCGGTCTCAGGACCCTCTCCTCACCCGTCGGCATGGCCATGGGAGCTCTCAGTTCCGGCTATCTAATG
AGACGGACCGGCAAGTTCGTCGGTCTGGGCATCGCGAGTGAACTGCTGTTAGTCGTGGGCGCGTCGCTGCTGTGC
TTGCAGAGTCAACACACGCCGGCTACCTTGACCACGGCCGCCTTCTTCTTCATCGGAGGCGGCTACAGCGCGGTG
CTCTCCGTGACGCAGATTGCCTGCATCGCGGCCGTGGATCACTCGCAACAGGCCGTCGTCACATCCATCACGTGT
AAGCCAGGACGCGTCCCGTCTGAGAGAGAGAGAGAGAGAGAGAGCGAGCCTATACTGACTCCTAGGGTGGCGATA
GTCCTCGCCCGCAGCTTGGGCGGCACCGTCGGCATCACCGTCGTGTCGGCCATCTATCAAAACACTCTGGACGCG
CGGCTGTGGTCGCGCTTTGGCGGCGAGCCGGACGCTGCGGCCATTATCGGCCGGCTGCGAGACGACATTGGCCAG
CTGCGCAACGTGCCGGCATCGTGGCGTCCGGGAGTCGTAGCCTCTTTCTCCGAGGCCTTTCGTTTCGTCTGGTTG
ACTGTTCTTGCCTGGTCGTTACTGGCTCTAGTCTGCGTCTCTCCTATCAAACAGCACAAACTGCATTCCTCGCTG
GATAGAAGA
Transcript >Ophio5|7266
ATGGCTTGCCCCGACGACAGCAACGAGATAGAGCAGCGGCCATCCGTCAGCTCCCAGACGGCGTCATGCTCCGAG
ACGACAAGACTGCTGCCGAAGAATGGTGGCGGTGGCGACGAGGAGGAGGAGGAGAGAACGGTCATCGTCAAGGAC
ATTTCCTTTACCAGGCTGGCGCTTATCATGAGCACCGCTTGGTCCGGTGTGTTCCTCGCCGCTCTCGACTCGACC
ATCATCGCTACCCTATCGGCGCCTATATCTAGCGAGTTTAACTCGCTGAGTCTATTCTCCTGGCTCGCTACCGGC
TATCTAATATCCACGGCTGCCTGTCAACCGATATCTGGTCGTCTTACCGATATCTTTGGACGGGGCCCCGGCCTC
ATCTTCTGTAACGTCGTCTTCGCCGTCGGTAATCTCATCTGCGGCTTAGCTATGAACCAACACGTCGTCATTGTT
GGTCGCGTCGTTGCTGGCATCGGTGGCGGTGGTCTGTTAAGCATCGCCACCTTTCTCGCCTCCGATCTGGTCCCT
CTCCGGCAACGCGGACTCGTCGGCGCCGTCGGTAACCTCTGGTTCGGGACTGGGTGTATGCTTGGTGGCGTCTTG
GGCGGCTTGCTAAACGATTATACGGCCTTGGGCTGGCGGCTTGCCTTTCTTATCCAGGTCCCGCCCTCTATACTG
TCTGCTATAGCCGTCATGTTGCTGGTCAAGGTGCCGCCCAAGCAGTCAGATCGGTCGCACCTGGCGAGGATCGAC
TTTCTCGGTGTTTTCCTAACCTCGTCCTTTCTAGTCCTGCTTGTCTTTGGCCTAAACGCGGGAGGCAATCTGACT
CCATGGCTTCACCCCCTACCAATTACCTGTCTGCTGCTTTCTCTTGTACTCTTCTTCACCTTTATATGGTGGGAA
AGTAGGGCTCGACAGCCCATTATTCCCGTGAAACTGCTACTTCACCGCACCGTCTTTTGCGCTTCTCTCACCGGC
CTCCTCGTCGCCATGCTGGTCAACACGGCCATCTTCTTCGTCCCGCTCTATCTGCAGATTCTAGGCGAGACGGCA
ACGAGCGCCGGTCTCAGGACCCTCTCCTCACCCGTCGGCATGGCCATGGGAGCTCTCAGTTCCGGCTATCTAATG
AGACGGACCGGCAAGTTCGTCGGTCTGGGCATCGCGAGTGAACTGCTGTTAGTCGTGGGCGCGTCGCTGCTGTGC
TTGCAGAGTCAACACACGCCGGCTACCTTGACCACGGCCGCCTTCTTCTTCATCGGAGGCGGCTACAGCGCGGTG
CTCTCCGTGACGCAGATTGCCTGCATCGCGGCCGTGGATCACTCGCAACAGGCCGTCGTCACATCCATCACGTGT
AAGCCAGGACGCGTCCCGTCTGAGAGAGAGAGAGAGAGAGAGAGCGAGCCTATACTGACTCCTAGGGTGGCGATA
GTCCTCGCCCGCAGCTTGGGCGGCACCGTCGGCATCACCGTCGTGTCGGCCATCTATCAAAACACTCTGGACGCG
CGGCTGTGGTCGCGCTTTGGCGGCGAGCCGGACGCTGCGGCCATTATCGGCCGGCTGCGAGACGACATTGGCCAG
CTGCGCAACGTGCCGGCATCGTGGCGTCCGGGAGTCGTAGCCTCTTTCTCCGAGGCCTTTCGTTTCGTCTGGTTG
ACTGTTCTTGCCTGGTCGTTACTGGCTCTAGTCTGCGTCTCTCCTATCAAACAGCACAAACTGCATTCCTCGCTG
GATAGAAGATGA
Gene >Ophio5|7266
ATGGCTTGCCCCGACGACAGCAACGAGATAGAGCAGCGGCCATCCGTCAGCTCCCAGACGGCGTCATGCTCCGAG
ACGACAAGACTGCTGCCGAAGAATGGTGGCGGTGGCGACGAGGAGGAGGAGGAGAGAACGGTCATCGTCAAGGAC
ATTTCCTTTACCAGGCTGGCGCTTATCATGAGCACCGCTTGGTCCGGTGTGTTCCTCGCCGCTCTCGACTCGACC
ATCATCGCTACCCTATCGGCGCCTATATCTAGCGAGTTTAACTCGCTGAGTCTATTCTCCTGGCTCGCTACCGGC
TATCTAATATCCACGGCTGCCTGTCAACCGATATCTGGTCGTCTTACCGATATCTTTGGACGGGGCCCCGGCCTC
ATCTTCTGTAACGTCGTCTTCGCCGTCGGTAATCTCATCTGCGGCTTAGCTATGAACCAACACGTCGTCATTGTT
GGTCGCGTCGTTGCTGGCATCGGTGGCGGTGGTCTGTTAAGCATCGCCACCTTTCTCGCCTCCGATCTGGTCCCT
CTCCGGCAACGCGGACTCGTCGGCGCCGTCGGTAACCTCTGGTTCGGGACTGGGTGTATGCTTGGTGGCGTCTTG
GGCGGCTTGCTAAACGATTATACGGCCTTGGGCTGGCGGCTTGCCTTTCTTATCCAGGTCCCGCCCTCTATACTG
TCTGCTATAGCCGTCATGTTGCTGGTCAAGGTGCCGCCCAAGCAGTCAGATCGGTCGCACCTGGCGAGGATCGAC
TTTCTCGGTGTTTTCCTAACCTCGTCCTTTCTAGTCCTGCTTGTCTTTGGCCTAAACGCGGGAGGCAATCTGACT
CCATGGCTTCACCCCCTACCAATTACCTGTCTGCTGCTTTCTCTTGTACTCTTCTTCACCTTTATATGGTGGGAA
AGTAGGGCTCGACAGCCCATTATTCCCGTGAAACTGCTACTTCACCGCACCGTCTTTTGCGCTTCTCTCACCGGC
CTCCTCGTCGCCATGCTGGTCAACACGGCCATCTTCTTCGTCCCGCTCTATCTGCAGATTCTAGGCGAGACGGCA
ACGAGCGCCGGTCTCAGGACCCTCTCCTCACCCGTCGGCATGGCCATGGGAGCTCTCAGTTCCGGCTATCTAATG
AGACGGACCGGCAAGTTCGTCGGTCTGGGCATCGCGAGTGAACTGCTGTTAGTCGTGGGCGCGTCGCTGCTGTGC
TTGCAGAGTCAACACACGCCGGCTACCTTGACCACGGCCGCCTTCTTCTTCATCGGAGGCGGCTACAGCGCGGTG
CTCTCCGTGACGCAGATTGCCTGCATCGCGGCCGTGGATCACTCGCAACAGGCCGTCGTCACATCCATCACGTGT
AAGCCAGGACGCGTCCCGTCTGAGAGAGAGAGAGAGAGAGAGAGCGAGCCTATACTGACTCCTAGGGTGGCGATA
GTCCTCGCCCGCAGCTTGGGCGGCACCGTCGGCATCACCGTCGTGTCGGCCATCTATCAAAACACTCTGGACGCG
CGGCTGTGGTCGCGCTTTGGCGGCGAGCCGGACGCTGCGGCCATTATCGGCCGGCTGCGAGACGACATTGGCCAG
CTGCGCAACGTGCCGGCATCGTGGCGTCCGGGAGTCGTAGCCTCTTTCTCCGAGGCCTTTCGTTTCGTCTGGTTG
ACTGTTCTTGCCTGGTCGTTACTGGCTCTAGTCTGCGTCTCTCCTATCAAACAGCACAAACTGCATTCCTCGCTG
GATAGAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail