Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7261
Gene name
Locationscaffold_69:48404..49871
Strand-
Gene length (bp)1467
Transcript length (bp)981
Coding sequence length (bp)978
Protein length (aa) 326

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06742 DUF1214 Protein of unknown function (DUF1214) 3.2E-19 186 285

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5324 0.3022 0.5046 0.1519 0.1652 0.0173 0.1157 0.0502 0.2378 0.261

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|513
Ophiocordyceps australis map64 (Brazil) OphauB2|5354
Ophiocordyceps camponoti-floridani Ophcf2|00923
Ophiocordyceps camponoti-rufipedis Ophun1|512
Ophiocordyceps kimflemingae Ophio5|4563
Ophiocordyceps kimflemingae Ophio5|7261 (this protein)
Ophiocordyceps subramaniannii Hirsu2|252
Ophiocordyceps subramaniannii Hirsu2|4440
Ophiocordyceps subramaniannii Hirsu2|6269
Ophiocordyceps subramaniannii Hirsu2|6270

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7261
MYGMVVPRILLRNHSSDLEAVHGIQDQIKVEKVSRSGPRLGPMLTNQLLGNGLLKPLAFQSPGSLGKDSAHNLLQ
VLSKVYQSNKPADPRDSYIVSRTLREAGVTCGFYDPPPGVDYALANRLISADLAAAERLLQPYNNGWFYFPDEYT
ADFGNHYTMRSRFAFRGYAPVVQSEAIYPEWIGNGSETLSLKGDECYIITFSGKPPVKGFWSLTLYNISSTFVAN
PLNRHSLGDQHPLTYSDGEPVYGRNNRTDPFAILLQPSDKAPPSNWTSNWLPTPAGGGAFAPMQPGKLTPDDSQQ
QEPHRNNPGCGKLDSMYGLGTDFSRP
Coding >Ophio5|7261
ATGTACGGCATGGTCGTGCCTCGCATCCTGCTACGAAACCACTCGTCGGACCTCGAAGCTGTGCATGGGATCCAG
GATCAAATCAAGGTTGAGAAAGTCAGTCGCTCAGGGCCGAGATTGGGGCCAATGCTCACGAACCAGCTGCTTGGA
AATGGGCTTCTCAAACCACTAGCTTTCCAATCACCTGGGTCACTAGGCAAAGACTCTGCGCACAATTTACTCCAG
GTTCTCTCCAAGGTCTACCAATCCAATAAGCCGGCCGATCCACGTGATAGCTACATCGTCTCAAGAACCCTTCGA
GAGGCCGGTGTGACATGCGGGTTCTATGATCCGCCGCCAGGGGTGGACTACGCGTTGGCGAATCGCCTGATCAGT
GCCGACTTGGCCGCAGCGGAACGACTATTACAGCCCTATAATAACGGCTGGTTCTATTTTCCCGACGAGTATACC
GCTGACTTTGGCAACCACTACACTATGAGAAGTCGTTTTGCTTTCCGAGGATATGCGCCCGTCGTTCAGTCCGAA
GCTATATACCCCGAGTGGATCGGCAATGGCAGTGAAACTCTGTCTCTAAAAGGCGACGAATGCTACATCATCACC
TTCTCGGGAAAACCTCCTGTCAAGGGCTTCTGGAGCTTGACTCTATACAACATTTCAAGCACGTTTGTCGCTAAT
CCGCTTAATCGTCACTCACTAGGAGATCAACATCCGTTAACCTATAGCGATGGCGAGCCAGTCTATGGCAGAAAT
AATCGTACTGATCCTTTTGCAATTCTCTTGCAGCCGAGCGACAAAGCACCTCCCTCTAACTGGACAAGCAACTGG
CTTCCTACACCAGCCGGAGGCGGCGCATTTGCTCCAATGCAACCTGGGAAACTGACGCCAGATGATTCCCAGCAG
CAAGAGCCCCATCGCAATAATCCAGGGTGCGGCAAACTTGACAGCATGTACGGTCTCGGAACAGATTTTTCGCGT
CCA
Transcript >Ophio5|7261
ATGTACGGCATGGTCGTGCCTCGCATCCTGCTACGAAACCACTCGTCGGACCTCGAAGCTGTGCATGGGATCCAG
GATCAAATCAAGGTTGAGAAAGTCAGTCGCTCAGGGCCGAGATTGGGGCCAATGCTCACGAACCAGCTGCTTGGA
AATGGGCTTCTCAAACCACTAGCTTTCCAATCACCTGGGTCACTAGGCAAAGACTCTGCGCACAATTTACTCCAG
GTTCTCTCCAAGGTCTACCAATCCAATAAGCCGGCCGATCCACGTGATAGCTACATCGTCTCAAGAACCCTTCGA
GAGGCCGGTGTGACATGCGGGTTCTATGATCCGCCGCCAGGGGTGGACTACGCGTTGGCGAATCGCCTGATCAGT
GCCGACTTGGCCGCAGCGGAACGACTATTACAGCCCTATAATAACGGCTGGTTCTATTTTCCCGACGAGTATACC
GCTGACTTTGGCAACCACTACACTATGAGAAGTCGTTTTGCTTTCCGAGGATATGCGCCCGTCGTTCAGTCCGAA
GCTATATACCCCGAGTGGATCGGCAATGGCAGTGAAACTCTGTCTCTAAAAGGCGACGAATGCTACATCATCACC
TTCTCGGGAAAACCTCCTGTCAAGGGCTTCTGGAGCTTGACTCTATACAACATTTCAAGCACGTTTGTCGCTAAT
CCGCTTAATCGTCACTCACTAGGAGATCAACATCCGTTAACCTATAGCGATGGCGAGCCAGTCTATGGCAGAAAT
AATCGTACTGATCCTTTTGCAATTCTCTTGCAGCCGAGCGACAAAGCACCTCCCTCTAACTGGACAAGCAACTGG
CTTCCTACACCAGCCGGAGGCGGCGCATTTGCTCCAATGCAACCTGGGAAACTGACGCCAGATGATTCCCAGCAG
CAAGAGCCCCATCGCAATAATCCAGGGTGCGGCAAACTTGACAGCATGTACGGTCTCGGAACAGATTTTTCGCGT
CCATAG
Gene >Ophio5|7261
ATGTACGGCATGGTCGTGCCTCGCATCCTGCTACGAAACCACTCGTCGGACCTCGAAGCTGTGCATGGGATCCAG
GATCAAATCAAGGTTGAGAAAGTCAGTCGCTCAGGGCCGAGATTGGGGCCAATGCTCACGAACCAGCTGCTTGGA
AATGGGCTTCTCAAACCACTAGCTTTCCAATCACCTGGGTCACTAGGCAAAGACTCTGCGCACAATTTACTCCAG
GTTCTCTCCAAGGTCTACCAATCCAATAAGCCGGCCGATCCACGTGATAGCTACATCGTCTCAAGAACCCTTCGA
GAGGCCGGTGTGACATGCGGGTTCTATGATCCGCCGCCAGGGGTGGACTACGCGTTGGCGAATCGCCTGATCAGT
GCCGACTTGGCCGCAGCGGAACGACTATTACAGCCCTATAATAACGGCTGGTTCTATTTTCCCGACGAGTATACC
GCTGACTTTGGCAACCACTACACTATGAGAAGTCGTTTTGCTTTCCGAGGATATGCGCCCGTCGTTCAGTCCGAA
GCTATATACCCCGAGTGGATCGGCAATGGCAGTGAAACTCTGTCTCTAAAAGGCGACGAATGCTACATCATCACC
TTCTCGGGAAAACCTCCTGTCAAGGGCTTCTGGAGCTTGACTCTATACAACATTTCAAGCACGTTTGTCGCTAAT
CCGCTTAATCGTCACTCACTAGGAGATCAACATCCGTTAACCTATAGCGATGGCGAGCCAGTCTATGGCAGAAAT
AATCGTACTGATCCTTTTGCAATTCTCTTGCAGCCGAGCGACAAAGCACCTCCCTCTAACTGGACAAGCAACTGG
CTTCCTACACCAGCCGGAGGCGGCGCATTTGCTCCAATGCGTAAGTTGATGCCATCCGCCCATAGTCTAGAAAGG
CAAAGCTTATTTTTCTCTTTGTCTCACGAAGTTCGCTTTTATGGCCCGGCCCGGCCGTTGTTTCCGAGAGGACGA
TATGTGTATCCAAAGCTATCGAAGCAAAGTGCTATAATCAACTGAGAAGAGTGCTCTTGCGGCGGATCGGTGTCT
ACATGGCCTAGTCGAGAGTATGTATATCGAGTAAAGCTTACTTATGCCATGTCCGGCTGTGTGCAATTGGTTTCG
CTCCCCAATTCTTCTTCTGTTATAGTGAGGTACTAAATTAATCACGTGCCCATTTCTTTTGCAAGGAAGTATGTA
AATTACAAGATGTGATGTTATCATGGACTTAGACGTAGTCAAGTCTAGTAGAATAAGTTGACCAGACAAGTGGTA
CAGGGCGAGAAAGAACAGAGAATTTAATATCCAGAAAGTTGTTATCTACCAAAGTCCATGTAGCTAATACACAAA
GAACCTGGGAAACTGACGCCAGATGATTCCCAGCAGCAAGAGCCCCATCGCAATAATCCAGGGTGCGGCAAACTT
GACAGCATGTACGGTCTCGGAACAGATTTTTCGCGTCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail