Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7257
Gene name
Locationscaffold_69:36090..37222
Strand+
Gene length (bp)1132
Transcript length (bp)1002
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02157 Man-6-P_recep Mannose-6-phosphate receptor 7.9E-14 172 283
PF09451 ATG27 Autophagy-related protein 27 1.9E-13 37 285
PF00878 CIMR Cation-independent mannose-6-phosphate receptor repeat 5.4E-05 178 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59745|YN29_SCHPO Putative mannose 6-phosphate receptor-like protein C530.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.09c PE=3 SV=1 37 289 2.0E-39
sp|Q75BD5|MRL1_ASHGO Mannose 6-phosphate receptor-like protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRL1 PE=3 SV=1 37 248 6.0E-13
sp|P24668|MPRD_MOUSE Cation-dependent mannose-6-phosphate receptor OS=Mus musculus GN=M6pr PE=1 SV=1 205 297 3.0E-08
sp|Q6AY20|MPRD_RAT Cation-dependent mannose-6-phosphate receptor OS=Rattus norvegicus GN=M6pr PE=1 SV=1 207 297 3.0E-08
sp|P11456|MPRD_BOVIN Cation-dependent mannose-6-phosphate receptor OS=Bos taurus GN=M6PR PE=1 SV=1 205 333 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59745|YN29_SCHPO Putative mannose 6-phosphate receptor-like protein C530.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.09c PE=3 SV=1 37 289 2.0E-39
sp|Q75BD5|MRL1_ASHGO Mannose 6-phosphate receptor-like protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRL1 PE=3 SV=1 37 248 6.0E-13
sp|P24668|MPRD_MOUSE Cation-dependent mannose-6-phosphate receptor OS=Mus musculus GN=M6pr PE=1 SV=1 205 297 3.0E-08
sp|Q6AY20|MPRD_RAT Cation-dependent mannose-6-phosphate receptor OS=Rattus norvegicus GN=M6pr PE=1 SV=1 207 297 3.0E-08
sp|P11456|MPRD_BOVIN Cation-dependent mannose-6-phosphate receptor OS=Bos taurus GN=M6PR PE=1 SV=1 205 333 5.0E-08
sp|P20645|MPRD_HUMAN Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens GN=M6PR PE=1 SV=1 205 333 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005537 mannose binding Yes
GO:0038023 signaling receptor activity Yes
GO:0007041 lysosomal transport Yes
GO:0046907 intracellular transport No
GO:0007034 vacuolar transport No
GO:0030246 carbohydrate binding No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0048029 monosaccharide binding No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0060089 molecular transducer activity No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 234 256 22
2 269 291 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7257
MRRLRFSAALLAGAVVSAITGDADSSSSSTTTTTTAPACTATSSTGSGAFFDLRPDLAGSPNKAKDYHAKGYDYG
SNFTLNICGSVVESVSEVVGVEKNLWANVSAYYTAHGNVYSIGSESMDLRSRGRKLVLQYAGGSPCGTKATKHRR
ATTPSKQQQHRVDTAAKKDDEDKASARRKSTTISFLCDKDPGSTQASVSFVGADADECAYFFEARSMHACAHAEP
HKPGSVGPGSVFGIILLIAVLVYVLGGVFYNRTVTNARGWRQLPNYSLWAGIGGFISDMFLAAWSWCCRYLPARR
GGYSYLNSNASSRHRNSDAENRLIDQLDEEWED
Coding >Ophio5|7257
ATGCGCCGCCTCCGTTTCTCCGCCGCCCTCCTCGCTGGCGCCGTCGTCTCCGCTATCACCGGAGATGCTGATTCT
TCATCATCATCGACGACGACGACGACGACGGCGCCCGCCTGTACCGCCACATCTTCCACCGGTAGCGGCGCCTTC
TTCGATCTACGTCCAGACCTGGCCGGATCTCCGAACAAGGCAAAGGATTACCACGCTAAGGGCTATGATTATGGG
AGCAACTTTACCCTCAATATCTGCGGCTCTGTTGTAGAGTCTGTGTCTGAGGTTGTCGGCGTCGAAAAGAATCTC
TGGGCCAATGTCAGCGCCTACTATACGGCTCATGGCAACGTCTACTCTATCGGATCCGAGTCGATGGACTTGCGC
AGTCGCGGGCGCAAACTCGTGCTCCAGTACGCTGGCGGCTCGCCATGTGGCACGAAAGCGACCAAGCATCGCCGA
GCCACAACTCCGTCTAAGCAACAGCAGCATCGCGTAGATACTGCCGCTAAAAAGGACGACGAGGACAAGGCGTCG
GCGAGGCGAAAGTCGACGACCATCTCTTTCCTCTGCGACAAGGACCCAGGCAGCACCCAGGCCAGCGTATCGTTT
GTCGGAGCCGACGCCGACGAGTGCGCCTATTTCTTCGAAGCCCGTTCCATGCACGCCTGTGCTCACGCTGAGCCT
CATAAGCCGGGCAGCGTCGGTCCGGGCAGTGTCTTTGGCATCATCCTCCTCATCGCCGTCCTCGTCTATGTCCTT
GGCGGCGTCTTCTACAACCGCACCGTTACAAACGCCCGCGGGTGGCGTCAGCTGCCCAATTACAGTCTTTGGGCC
GGCATTGGTGGCTTCATCAGCGACATGTTTCTCGCGGCCTGGTCCTGGTGCTGTCGCTACTTGCCGGCTCGTCGA
GGAGGCTACAGCTACCTAAACTCGAATGCGAGCAGTCGGCATCGAAACTCGGATGCGGAAAACCGGCTAATTGAC
CAGCTGGATGAAGAGTGGGAAGAC
Transcript >Ophio5|7257
ATGCGCCGCCTCCGTTTCTCCGCCGCCCTCCTCGCTGGCGCCGTCGTCTCCGCTATCACCGGAGATGCTGATTCT
TCATCATCATCGACGACGACGACGACGACGGCGCCCGCCTGTACCGCCACATCTTCCACCGGTAGCGGCGCCTTC
TTCGATCTACGTCCAGACCTGGCCGGATCTCCGAACAAGGCAAAGGATTACCACGCTAAGGGCTATGATTATGGG
AGCAACTTTACCCTCAATATCTGCGGCTCTGTTGTAGAGTCTGTGTCTGAGGTTGTCGGCGTCGAAAAGAATCTC
TGGGCCAATGTCAGCGCCTACTATACGGCTCATGGCAACGTCTACTCTATCGGATCCGAGTCGATGGACTTGCGC
AGTCGCGGGCGCAAACTCGTGCTCCAGTACGCTGGCGGCTCGCCATGTGGCACGAAAGCGACCAAGCATCGCCGA
GCCACAACTCCGTCTAAGCAACAGCAGCATCGCGTAGATACTGCCGCTAAAAAGGACGACGAGGACAAGGCGTCG
GCGAGGCGAAAGTCGACGACCATCTCTTTCCTCTGCGACAAGGACCCAGGCAGCACCCAGGCCAGCGTATCGTTT
GTCGGAGCCGACGCCGACGAGTGCGCCTATTTCTTCGAAGCCCGTTCCATGCACGCCTGTGCTCACGCTGAGCCT
CATAAGCCGGGCAGCGTCGGTCCGGGCAGTGTCTTTGGCATCATCCTCCTCATCGCCGTCCTCGTCTATGTCCTT
GGCGGCGTCTTCTACAACCGCACCGTTACAAACGCCCGCGGGTGGCGTCAGCTGCCCAATTACAGTCTTTGGGCC
GGCATTGGTGGCTTCATCAGCGACATGTTTCTCGCGGCCTGGTCCTGGTGCTGTCGCTACTTGCCGGCTCGTCGA
GGAGGCTACAGCTACCTAAACTCGAATGCGAGCAGTCGGCATCGAAACTCGGATGCGGAAAACCGGCTAATTGAC
CAGCTGGATGAAGAGTGGGAAGACTAA
Gene >Ophio5|7257
ATGCGCCGCCTCCGTTTCTCCGCCGCCCTCCTCGCTGGCGCCGTCGTCTCCGCTATCACCGGAGATGCTGATTCT
TCATCATCATCGACGACGACGACGACGACGGCGCCCGCCTGTACCGCCACATCTTCCACCGGTAGCGGCGCCTTC
TTCGATCTACGTCCAGACCTGGCCGGATCTCCGAACAAGGCAAAGGATTACCACGCTAAGGGCTATGATTATGGG
AGCAACTTTACCCTCAATATCTGCGGCTCTGTTGTAGAGTCTGTGTCTGAGGTTGTCGGCGTCGAAAAGAATCTC
TGGGCCAATGTCAGCGCCTACTATACGGCTCATGGCAACGTCTACTCTATCGGGTACGACACCCTTTTTTCTCTC
TCTCCTTACTCGAGCTTCGAGCTGCTGACGCCGGTCGCAGATCCGAGTCGATGGACTTGCGCAGTCGCGGGCGCA
AACTCGTGCTCCAGTACGCTGGCGGCTCGCCATGTGGCACGAAAGCGACCAAGCATCGCCGAGCCACAACTCCGT
CTAAGCAACAGCAGCATCGCGTAGATACTGCCGCTAAAAAGGACGACGAGGACAAGGCGTCGGCGAGGCGAAAGT
CGACGACCATCTCTTTCCTCTGCGACAAGGACCCAGGCAGCACCCAGGCCAGCGTATCGTTTGTCGGAGCCGACG
CCGACGAGTGCGCCTATTTCTTCGAAGCCCGTTCCATGCACGCCTGTGCTCACGCTGAGCCTCATAAGCCGGGCA
GCGTCGGTCCGGGCAGTGTCTTTGGCATCATCCTCCTCATCGCCGTCCTCGTCTATGTCCTTGGCGGCGTCTTCT
ACAACCGCACCGTTACAAACGCCCGCGGGTGGCGTCAGCTGCCCAATTACAGTCTTTGGGCCGGCATTGGTGGCT
TCATCAGCGTGCGTCCTTTGCGGCCGGAGCCGAGTTTCCCACTACACCGGCGGCGGGCGGGCTGACAGGCGTGCA
GGACATGTTTCTCGCGGCCTGGTCCTGGTGCTGTCGCTACTTGCCGGCTCGTCGAGGAGGCTACAGCTACCTAAA
CTCGAATGCGAGCAGTCGGCATCGAAACTCGGATGCGGAAAACCGGCTAATTGACCAGCTGGATGAAGAGTGGGA
AGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail