Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7255
Gene name
Locationscaffold_69:29235..31973
Strand-
Gene length (bp)2738
Transcript length (bp)2622
Coding sequence length (bp)2619
Protein length (aa) 873

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 5.9E-44 409 667
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 7.6E-31 105 347
PF14310 Fn3-like Fibronectin type III-like domain 6.1E-17 794 863

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 1 872 0.0E+00
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 31 872 0.0E+00
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 8 872 0.0E+00
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 8 872 0.0E+00
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 33 872 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 1 872 0.0E+00
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 31 872 0.0E+00
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 8 872 0.0E+00
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 8 872 0.0E+00
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 33 872 0.0E+00
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 8 872 0.0E+00
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 31 872 0.0E+00
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 31 872 0.0E+00
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 4 872 0.0E+00
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 4 872 0.0E+00
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 12 872 0.0E+00
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 41 872 0.0E+00
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 33 802 0.0E+00
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 35 868 0.0E+00
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 35 868 0.0E+00
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 35 870 0.0E+00
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 32 866 0.0E+00
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 22 866 0.0E+00
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 1 872 0.0E+00
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 22 866 0.0E+00
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 31 866 0.0E+00
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 1 872 0.0E+00
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 1 866 0.0E+00
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 36 868 0.0E+00
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 36 868 0.0E+00
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 35 868 0.0E+00
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 33 872 0.0E+00
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 1 872 0.0E+00
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 49 678 0.0E+00
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 49 678 0.0E+00
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 49 681 0.0E+00
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 49 678 0.0E+00
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 49 673 0.0E+00
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 49 678 9.0E-177
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 32 770 2.0E-170
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 32 697 1.0E-154
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 32 697 1.0E-154
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 33 678 1.0E-153
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 32 697 8.0E-153
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 33 680 2.0E-151
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 6 678 9.0E-151
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 10 678 4.0E-150
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 33 678 7.0E-148
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 33 678 2.0E-147
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 33 680 7.0E-143
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 33 688 9.0E-143
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 32 697 8.0E-140
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 32 697 3.0E-138
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 28 679 1.0E-137
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 1 692 3.0E-109
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 49 698 8.0E-109
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 49 698 3.0E-106
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 228 679 1.0E-66
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 57 683 4.0E-61
sp|F6C6C1|APY_BIFBA Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) GN=HMPREF9228_1477 PE=1 SV=1 60 682 9.0E-49
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 60 682 1.0E-48
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 54 675 2.0E-48
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 58 433 4.0E-47
sp|P29091|BGLS_SCHCO Beta-glucosidase (Fragment) OS=Schizophyllum commune PE=2 SV=1 464 646 4.0E-47
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 226 697 5.0E-46
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 60 481 4.0E-42
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 60 520 2.0E-41
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 60 520 1.0E-40
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 60 520 1.0E-40
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 60 491 2.0E-40
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 60 490 3.0E-40
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 31 433 8.0E-40
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 60 443 9.0E-40
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 60 505 3.0E-39
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 58 481 4.0E-38
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 85 433 4.0E-38
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 58 481 5.0E-38
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 58 314 1.0E-37
sp|Q94KD8|BXL2_ARATH Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1 55 673 8.0E-36
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 54 486 6.0E-35
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 56 314 2.0E-34
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 67 443 6.0E-33
sp|Q9LJN4|BXL5_ARATH Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2 54 671 8.0E-33
sp|Q4WA69|BGLK_ASPFU Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglK PE=3 SV=1 64 443 7.0E-32
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 85 318 4.0E-31
sp|A5JTQ3|XYL2_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia GN=Xyl2 PE=2 SV=1 54 677 8.0E-30
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 60 318 1.0E-29
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 60 318 2.0E-29
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 60 318 2.0E-29
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 56 312 8.0E-29
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 67 363 1.0E-28
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 60 318 2.0E-28
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 60 318 2.0E-28
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 53 677 1.0E-26
sp|Q9FLG1|BXL4_ARATH Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1 55 677 2.0E-26
sp|Q9LXA8|BXL6_ARATH Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana GN=BXL6 PE=2 SV=1 27 676 9.0E-26
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 50 680 3.0E-25
sp|Q9LXD6|BXL3_ARATH Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1 54 680 2.0E-24
sp|Q0CB82|BXLB_ASPTN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bxlB PE=3 SV=1 55 672 5.0E-24
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 88 715 2.0E-23
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 15 319 5.0E-23
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 49 209 2.0E-22
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 55 672 2.0E-22
sp|B0YBJ3|BGLK_ASPFC Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglK PE=3 SV=1 64 443 1.0E-21
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 55 672 1.0E-21
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 55 672 2.0E-21
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 756 869 4.0E-21
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 756 869 4.0E-21
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 756 869 6.0E-21
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 767 868 1.0E-20
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 767 868 1.0E-20
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 758 868 1.0E-20
sp|A5JTQ2|XYL1_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia GN=Xyl1 PE=1 SV=1 55 687 1.0E-20
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 58 300 2.0E-20
sp|B6EY09|XYND_ASPJA Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus japonicus GN=xlnD PE=1 SV=1 53 696 2.0E-19
sp|B8MYV0|XYND_ASPFN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnD PE=3 SV=1 53 671 3.0E-19
sp|C0STH4|XYND_ASPAC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus aculeatus GN=xlnD PE=3 SV=1 53 696 3.0E-19
sp|Q2UR38|XYND_ASPOR Exo-1,4-beta-xylosidase xlnD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnD PE=1 SV=1 55 671 6.0E-19
sp|Q5BAS1|XYND_EMENI Exo-1,4-beta-xylosidase xlnD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnD PE=1 SV=1 55 668 2.0E-18
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 54 697 7.0E-18
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 111 678 8.0E-18
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 768 869 9.0E-18
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 54 697 1.0E-17
sp|P29090|BGL3_ASPWE Beta-glucosidase A-3 (Fragment) OS=Aspergillus wentii PE=1 SV=1 278 338 1.0E-17
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 767 869 3.0E-17
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 55 672 3.0E-17
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 29 678 5.0E-17
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 768 872 6.0E-17
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 769 869 3.0E-16
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 768 866 2.0E-15
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 743 866 1.0E-14
sp|O00089|XYND_ASPNG Exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger GN=xlnD PE=1 SV=2 53 671 2.0E-14
sp|A2QA27|XYND_ASPNC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnD PE=3 SV=1 53 671 2.0E-14
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 768 866 4.0E-14
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 768 866 4.0E-14
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 529 677 8.0E-14
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 750 866 1.0E-13
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 768 866 1.0E-13
sp|Q4AEG8|XYND_ASPAW Exo-1,4-beta-xylosidase xlnD OS=Aspergillus awamori GN=xlnD PE=2 SV=1 53 671 1.0E-13
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 768 872 2.0E-13
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 750 866 3.0E-13
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 750 866 3.0E-13
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 768 868 4.0E-13
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 768 872 4.0E-13
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 529 678 4.0E-13
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 768 866 5.0E-13
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 529 724 7.0E-13
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 40 458 7.0E-13
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 529 680 8.0E-13
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 529 724 1.0E-12
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 768 869 2.0E-12
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 529 680 2.0E-12
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 529 678 3.0E-12
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 529 678 4.0E-12
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 529 680 4.0E-12
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 529 680 7.0E-12
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 55 292 9.0E-12
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 529 724 2.0E-11
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 529 672 2.0E-11
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 529 724 3.0E-11
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 529 678 3.0E-11
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 529 700 3.0E-11
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 529 678 4.0E-11
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 768 868 7.0E-11
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 55 277 1.0E-10
sp|P83344|XYNB_PRUPE Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1 523 673 2.0E-10
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 529 679 3.0E-10
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 529 671 4.0E-10
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 55 277 8.0E-10
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 55 277 8.0E-10
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 758 872 2.0E-09
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 407 672 4.0E-09
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 101 354 4.0E-09
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 521 679 5.0E-09
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 55 430 6.0E-09
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 468 673 7.0E-09
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 407 672 7.0E-09
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 407 672 7.0E-09
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 777 871 6.0E-08
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 529 671 1.0E-07
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 529 671 1.0E-07
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 529 672 4.0E-07
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 529 672 4.0E-07
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 529 671 3.0E-06
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 528 679 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.197 0.1031 0.8641 0.1074 0.067 0.0191 0.1898 0.2722 0.1268 0.003

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999351

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 2.7E-57 89 309

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup338
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2687
Ophiocordyceps australis 1348a (Ghana) OphauG2|5011
Ophiocordyceps australis map64 (Brazil) OphauB2|3993
Ophiocordyceps australis map64 (Brazil) OphauB2|7961
Ophiocordyceps camponoti-floridani Ophcf2|06979
Ophiocordyceps camponoti-rufipedis Ophun1|7254
Ophiocordyceps kimflemingae Ophio5|7255 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4268
Ophiocordyceps subramaniannii Hirsu2|5736

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7255
MKLLSTVVAAGLAASIDAAVLELAPRDAHPAYSPPFYPSPWMDPEAKGWTEAYAKAREFVSRLTLTEKVNLTTGT
GWQSSACVGNTGTIPRFGMRSLCMQDSPLGLRFTDQNSAFPAGITAGATWSRKIWKKRGKQMGAEAYGKGVDVLL
GPVSGPIGRSPEAGRNSEGFGSDPCLQGRALASTSQGIQSSGVIACAKHFVVNEQERFRQADEARSQGFNVTESL
SSNVDDKTMHEVYAWPFADAVRAGVGSVMCSYNQINNSYGCQNSKLINGILKAEMGFQGFVMSDWQAQHSGVGSA
HAGLDMSMPGDTVFGSGYSYWGSNLTLSVLNGTVPAWRVDDMATRIMAAYFKVGKTIGGGVETNFNSWTLETKGW
ADAAAKVDWTVVNKHVNVQADHGTFIRECAAKGTVILKNEGALPLEKPHFVAVVGEDAGPNPKGPNGCPDRGCDN
GTLAMLWGSGTANFPYLVTPDDALRKQAAADGSRYESVLSNYAWEETRALVSKPDATAIVFVNSDGGEGFIVVDG
NIGDRNNLTLWHNGDDLVKNVASVNPNTIVVIHSVGAVLVTDWYKNPNITAIVWAGLPGQESGNSLVDILYGKAS
PGRSPFTWGPTRESYGTDILYLPNNGQKAPQVDFDEGVFIDYRYFDKYAPKNNQPGSPIYEFGYGLSWSTFEYAN
LKVEKHGVRAMRPVSEKTTAAPTLGKYSNKLGDYLFPKGMSYVPLWIYPWLNSSSSGQQSSATPEYGRPADSLPA
GATDGSPQPRLASAGGQGGNDQLWDVMYAVTCVITNTGNRTTDEIAQLYITLGGPNEPIRVLRGFERLEGIAPGK
SVEFRAELTRRDLSNWDVASQNWVITPYPKRVWVGSSSRDLPLSAILN
Coding >Ophio5|7255
ATGAAACTGCTGTCGACTGTCGTCGCGGCAGGGCTGGCGGCATCCATCGATGCCGCCGTCTTGGAGCTGGCTCCT
CGCGACGCCCACCCTGCCTATTCACCTCCTTTCTACCCGTCTCCATGGATGGACCCCGAGGCCAAAGGCTGGACC
GAGGCCTACGCCAAGGCCAGAGAATTCGTCTCTCGCTTGACACTGACGGAGAAGGTCAACCTCACGACCGGCACT
GGCTGGCAGTCCAGTGCTTGTGTCGGTAACACGGGCACTATTCCTCGTTTCGGCATGCGGTCCTTGTGCATGCAG
GATTCGCCGCTCGGTTTGCGCTTCACAGATCAGAACAGCGCGTTCCCTGCCGGTATCACGGCCGGAGCCACCTGG
AGCAGGAAGATATGGAAGAAGAGAGGGAAACAGATGGGTGCTGAGGCCTACGGTAAGGGAGTCGATGTCCTTCTG
GGCCCCGTCTCCGGCCCCATTGGCCGCTCTCCCGAGGCTGGCCGCAACTCCGAAGGCTTCGGCTCCGATCCCTGT
CTGCAGGGCCGCGCTCTGGCCAGCACTTCGCAGGGAATCCAGTCTTCAGGCGTCATCGCCTGTGCCAAGCACTTT
GTCGTCAATGAGCAGGAGCGTTTCAGACAGGCCGACGAGGCTCGGTCGCAAGGCTTCAACGTCACCGAGTCCCTG
TCGTCCAACGTCGACGACAAGACGATGCACGAGGTGTATGCCTGGCCCTTTGCCGACGCTGTGCGTGCCGGTGTA
GGCTCCGTCATGTGCTCGTACAACCAGATCAACAACTCGTACGGCTGTCAAAACTCCAAGCTCATCAATGGTATC
CTCAAGGCCGAGATGGGCTTCCAGGGCTTCGTCATGAGCGACTGGCAGGCCCAGCACTCGGGCGTCGGCTCCGCC
CATGCCGGCCTCGACATGTCTATGCCGGGCGACACTGTCTTTGGTTCTGGCTACAGCTATTGGGGTAGCAACCTG
ACGCTCTCTGTTCTCAATGGAACCGTGCCCGCCTGGCGCGTCGATGACATGGCTACGCGTATCATGGCCGCTTAT
TTCAAGGTCGGAAAGACGATTGGTGGCGGCGTCGAGACCAACTTCAACTCGTGGACTTTGGAAACCAAGGGCTGG
GCCGATGCCGCTGCCAAGGTGGATTGGACCGTCGTCAACAAGCACGTCAACGTCCAAGCTGACCATGGCACCTTC
ATCCGCGAGTGCGCCGCGAAAGGCACCGTCATCCTCAAGAATGAGGGCGCCCTGCCACTGGAGAAGCCTCACTTT
GTCGCTGTCGTCGGCGAGGATGCAGGCCCCAACCCCAAAGGCCCCAACGGATGCCCCGACCGCGGCTGTGACAAT
GGCACCCTCGCCATGCTTTGGGGATCGGGAACCGCCAACTTCCCGTATCTCGTCACGCCTGATGATGCCTTGAGG
AAACAAGCCGCCGCCGACGGCTCCCGCTACGAGAGTGTCCTGTCCAACTACGCCTGGGAGGAGACGCGTGCCCTC
GTCTCAAAGCCCGACGCGACGGCCATTGTCTTTGTCAACTCGGATGGCGGAGAGGGCTTCATCGTCGTGGACGGC
AACATCGGCGATCGAAACAACCTTACGCTTTGGCACAACGGTGACGATCTCGTCAAGAATGTCGCATCCGTCAAC
CCAAACACCATCGTCGTCATTCACAGCGTCGGCGCCGTCCTGGTCACCGACTGGTACAAGAACCCCAATATCACG
GCCATCGTCTGGGCCGGACTGCCTGGTCAGGAGTCTGGTAACTCTCTTGTCGACATCCTGTACGGCAAGGCGAGC
CCAGGTCGGTCGCCCTTTACCTGGGGCCCGACGCGTGAAAGCTACGGCACAGACATCTTGTATCTGCCCAACAAT
GGCCAGAAGGCACCCCAAGTCGACTTCGACGAGGGTGTCTTCATCGACTACCGCTACTTTGACAAGTACGCTCCC
AAGAATAACCAGCCGGGCTCGCCCATCTACGAATTCGGCTACGGCCTGTCGTGGTCGACATTTGAGTATGCCAAT
CTCAAGGTCGAGAAGCATGGCGTGCGGGCTATGCGTCCCGTATCCGAGAAGACGACGGCCGCTCCTACGCTGGGC
AAATACAGCAACAAGCTGGGCGACTACTTGTTCCCCAAAGGCATGTCGTACGTGCCACTTTGGATCTACCCCTGG
CTCAACTCGTCCTCGTCCGGGCAGCAGTCGTCGGCGACGCCCGAGTATGGCCGGCCCGCCGACTCCCTCCCTGCT
GGGGCGACGGACGGCTCTCCCCAGCCCAGGCTGGCGTCGGCCGGCGGACAGGGCGGCAACGATCAGCTTTGGGAC
GTCATGTACGCTGTGACGTGCGTCATCACCAACACGGGTAATCGGACGACGGACGAGATTGCGCAGCTCTACATC
ACTCTGGGCGGGCCGAACGAGCCGATACGCGTGCTCCGGGGCTTTGAACGGCTCGAGGGCATCGCGCCGGGCAAG
AGCGTCGAGTTCCGCGCGGAGCTTACGCGTCGAGATTTGAGCAACTGGGATGTGGCGTCTCAGAACTGGGTCATT
ACGCCGTATCCGAAGCGTGTTTGGGTGGGCAGTAGCTCGCGCGACTTGCCGCTGAGTGCGATTCTGAAT
Transcript >Ophio5|7255
ATGAAACTGCTGTCGACTGTCGTCGCGGCAGGGCTGGCGGCATCCATCGATGCCGCCGTCTTGGAGCTGGCTCCT
CGCGACGCCCACCCTGCCTATTCACCTCCTTTCTACCCGTCTCCATGGATGGACCCCGAGGCCAAAGGCTGGACC
GAGGCCTACGCCAAGGCCAGAGAATTCGTCTCTCGCTTGACACTGACGGAGAAGGTCAACCTCACGACCGGCACT
GGCTGGCAGTCCAGTGCTTGTGTCGGTAACACGGGCACTATTCCTCGTTTCGGCATGCGGTCCTTGTGCATGCAG
GATTCGCCGCTCGGTTTGCGCTTCACAGATCAGAACAGCGCGTTCCCTGCCGGTATCACGGCCGGAGCCACCTGG
AGCAGGAAGATATGGAAGAAGAGAGGGAAACAGATGGGTGCTGAGGCCTACGGTAAGGGAGTCGATGTCCTTCTG
GGCCCCGTCTCCGGCCCCATTGGCCGCTCTCCCGAGGCTGGCCGCAACTCCGAAGGCTTCGGCTCCGATCCCTGT
CTGCAGGGCCGCGCTCTGGCCAGCACTTCGCAGGGAATCCAGTCTTCAGGCGTCATCGCCTGTGCCAAGCACTTT
GTCGTCAATGAGCAGGAGCGTTTCAGACAGGCCGACGAGGCTCGGTCGCAAGGCTTCAACGTCACCGAGTCCCTG
TCGTCCAACGTCGACGACAAGACGATGCACGAGGTGTATGCCTGGCCCTTTGCCGACGCTGTGCGTGCCGGTGTA
GGCTCCGTCATGTGCTCGTACAACCAGATCAACAACTCGTACGGCTGTCAAAACTCCAAGCTCATCAATGGTATC
CTCAAGGCCGAGATGGGCTTCCAGGGCTTCGTCATGAGCGACTGGCAGGCCCAGCACTCGGGCGTCGGCTCCGCC
CATGCCGGCCTCGACATGTCTATGCCGGGCGACACTGTCTTTGGTTCTGGCTACAGCTATTGGGGTAGCAACCTG
ACGCTCTCTGTTCTCAATGGAACCGTGCCCGCCTGGCGCGTCGATGACATGGCTACGCGTATCATGGCCGCTTAT
TTCAAGGTCGGAAAGACGATTGGTGGCGGCGTCGAGACCAACTTCAACTCGTGGACTTTGGAAACCAAGGGCTGG
GCCGATGCCGCTGCCAAGGTGGATTGGACCGTCGTCAACAAGCACGTCAACGTCCAAGCTGACCATGGCACCTTC
ATCCGCGAGTGCGCCGCGAAAGGCACCGTCATCCTCAAGAATGAGGGCGCCCTGCCACTGGAGAAGCCTCACTTT
GTCGCTGTCGTCGGCGAGGATGCAGGCCCCAACCCCAAAGGCCCCAACGGATGCCCCGACCGCGGCTGTGACAAT
GGCACCCTCGCCATGCTTTGGGGATCGGGAACCGCCAACTTCCCGTATCTCGTCACGCCTGATGATGCCTTGAGG
AAACAAGCCGCCGCCGACGGCTCCCGCTACGAGAGTGTCCTGTCCAACTACGCCTGGGAGGAGACGCGTGCCCTC
GTCTCAAAGCCCGACGCGACGGCCATTGTCTTTGTCAACTCGGATGGCGGAGAGGGCTTCATCGTCGTGGACGGC
AACATCGGCGATCGAAACAACCTTACGCTTTGGCACAACGGTGACGATCTCGTCAAGAATGTCGCATCCGTCAAC
CCAAACACCATCGTCGTCATTCACAGCGTCGGCGCCGTCCTGGTCACCGACTGGTACAAGAACCCCAATATCACG
GCCATCGTCTGGGCCGGACTGCCTGGTCAGGAGTCTGGTAACTCTCTTGTCGACATCCTGTACGGCAAGGCGAGC
CCAGGTCGGTCGCCCTTTACCTGGGGCCCGACGCGTGAAAGCTACGGCACAGACATCTTGTATCTGCCCAACAAT
GGCCAGAAGGCACCCCAAGTCGACTTCGACGAGGGTGTCTTCATCGACTACCGCTACTTTGACAAGTACGCTCCC
AAGAATAACCAGCCGGGCTCGCCCATCTACGAATTCGGCTACGGCCTGTCGTGGTCGACATTTGAGTATGCCAAT
CTCAAGGTCGAGAAGCATGGCGTGCGGGCTATGCGTCCCGTATCCGAGAAGACGACGGCCGCTCCTACGCTGGGC
AAATACAGCAACAAGCTGGGCGACTACTTGTTCCCCAAAGGCATGTCGTACGTGCCACTTTGGATCTACCCCTGG
CTCAACTCGTCCTCGTCCGGGCAGCAGTCGTCGGCGACGCCCGAGTATGGCCGGCCCGCCGACTCCCTCCCTGCT
GGGGCGACGGACGGCTCTCCCCAGCCCAGGCTGGCGTCGGCCGGCGGACAGGGCGGCAACGATCAGCTTTGGGAC
GTCATGTACGCTGTGACGTGCGTCATCACCAACACGGGTAATCGGACGACGGACGAGATTGCGCAGCTCTACATC
ACTCTGGGCGGGCCGAACGAGCCGATACGCGTGCTCCGGGGCTTTGAACGGCTCGAGGGCATCGCGCCGGGCAAG
AGCGTCGAGTTCCGCGCGGAGCTTACGCGTCGAGATTTGAGCAACTGGGATGTGGCGTCTCAGAACTGGGTCATT
ACGCCGTATCCGAAGCGTGTTTGGGTGGGCAGTAGCTCGCGCGACTTGCCGCTGAGTGCGATTCTGAATTGA
Gene >Ophio5|7255
ATGAAACTGCTGTCGACTGTCGTCGCGGCAGGGCTGGCGGCATCCATCGATGCCGCCGTCTTGGAGCTGGCTCCT
CGCGACGCCCACCCTGCCTATTCACCTCCTTTCTACCCGTCTCCATGGATGGACCCCGAGGCCAAAGGCTGGACC
GAGGCCTACGCCAAGGCCAGAGAATTCGTCTCTCGCTTGACACTGACGGAGAAGGTCAACCTCACGACCGGCACT
GGGTTAGTAGGACCAACAAATCTTCCTTGTTCGAACTGTGGCTGACGATATCTTCTCTCCAGCTGGCAGTCCAGT
GCTTGTGTCGGTAACACGGGCACTATTCCTCGTTTCGGCATGCGGTCCTTGTGCATGCAGGATTCGCCGCTCGGT
TTGCGCTTCACAGATCAGAACAGCGCGTTCCCTGCCGGTATCACGGCCGGAGCCACCTGGAGCAGGAAGATATGG
AAGAAGAGAGGGAAACAGATGGGTGCTGAGGCCTACGGTAAGGGAGTCGATGTCCTTCTGGGCCCCGTCTCCGGC
CCCATTGGCCGCTCTCCCGAGGCTGGCCGCAACTCCGAAGGCTTCGGCTCCGATCCCTGTCTGCAGGGCCGCGCT
CTGGCCAGCACTTCGCAGGGAATCCAGTCTTCAGGCGTCATCGCCTGTGCCAAGCACTTTGTCGTCAATGAGCAG
GGTGAGTCTACCCCTTTCTACTCTCTTCACTGTTCTTCCTTATTGAGACAACATCAGAGCGTTTCAGACAGGCCG
ACGAGGCTCGGTCGCAAGGCTTCAACGTCACCGAGTCCCTGTCGTCCAACGTCGACGACAAGACGATGCACGAGG
TGTATGCCTGGCCCTTTGCCGACGCTGTGCGTGCCGGTGTAGGCTCCGTCATGTGCTCGTACAACCAGATCAACA
ACTCGTACGGCTGTCAAAACTCCAAGCTCATCAATGGTATCCTCAAGGCCGAGATGGGCTTCCAGGGCTTCGTCA
TGAGCGACTGGCAGGCCCAGCACTCGGGCGTCGGCTCCGCCCATGCCGGCCTCGACATGTCTATGCCGGGCGACA
CTGTCTTTGGTTCTGGCTACAGCTATTGGGGTAGCAACCTGACGCTCTCTGTTCTCAATGGAACCGTGCCCGCCT
GGCGCGTCGATGACATGGCTACGCGTATCATGGCCGCTTATTTCAAGGTCGGAAAGACGATTGGTGGCGGCGTCG
AGACCAACTTCAACTCGTGGACTTTGGAAACCAAGGGCTGGGCCGATGCCGCTGCCAAGGTGGATTGGACCGTCG
TCAACAAGCACGTCAACGTCCAAGCTGACCATGGCACCTTCATCCGCGAGTGCGCCGCGAAAGGCACCGTCATCC
TCAAGAATGAGGGCGCCCTGCCACTGGAGAAGCCTCACTTTGTCGCTGTCGTCGGCGAGGATGCAGGCCCCAACC
CCAAAGGCCCCAACGGATGCCCCGACCGCGGCTGTGACAATGGCACCCTCGCCATGCTTTGGGGATCGGGAACCG
CCAACTTCCCGTATCTCGTCACGCCTGATGATGCCTTGAGGAAACAAGCCGCCGCCGACGGCTCCCGCTACGAGA
GTGTCCTGTCCAACTACGCCTGGGAGGAGACGCGTGCCCTCGTCTCAAAGCCCGACGCGACGGCCATTGTCTTTG
TCAACTCGGATGGCGGAGAGGGCTTCATCGTCGTGGACGGCAACATCGGCGATCGAAACAACCTTACGCTTTGGC
ACAACGGTGACGATCTCGTCAAGAATGTCGCATCCGTCAACCCAAACACCATCGTCGTCATTCACAGCGTCGGCG
CCGTCCTGGTCACCGACTGGTACAAGAACCCCAATATCACGGCCATCGTCTGGGCCGGACTGCCTGGTCAGGAGT
CTGGTAACTCTCTTGTCGACATCCTGTACGGCAAGGCGAGCCCAGGTCGGTCGCCCTTTACCTGGGGCCCGACGC
GTGAAAGCTACGGCACAGACATCTTGTATCTGCCCAACAATGGCCAGAAGGCACCCCAAGTCGACTTCGACGAGG
GTGTCTTCATCGACTACCGCTACTTTGACAAGTACGCTCCCAAGAATAACCAGCCGGGCTCGCCCATCTACGAAT
TCGGCTACGGCCTGTCGTGGTCGACATTTGAGTATGCCAATCTCAAGGTCGAGAAGCATGGCGTGCGGGCTATGC
GTCCCGTATCCGAGAAGACGACGGCCGCTCCTACGCTGGGCAAATACAGCAACAAGCTGGGCGACTACTTGTTCC
CCAAAGGCATGTCGTACGTGCCACTTTGGATCTACCCCTGGCTCAACTCGTCCTCGTCCGGGCAGCAGTCGTCGG
CGACGCCCGAGTATGGCCGGCCCGCCGACTCCCTCCCTGCTGGGGCGACGGACGGCTCTCCCCAGCCCAGGCTGG
CGTCGGCCGGCGGACAGGGCGGCAACGATCAGCTTTGGGACGTCATGTACGCTGTGACGTGCGTCATCACCAACA
CGGGTAATCGGACGACGGACGAGATTGCGCAGCTCTACATCACTCTGGGCGGGCCGAACGAGCCGATACGCGTGC
TCCGGGGCTTTGAACGGCTCGAGGGCATCGCGCCGGGCAAGAGCGTCGAGTTCCGCGCGGAGCTTACGCGTCGAG
ATTTGAGCAACTGGGATGTGGCGTCTCAGAACTGGGTCATTACGCCGTATCCGAAGCGTGTTTGGGTGGGCAGTA
GCTCGCGCGACTTGCCGCTGAGTGCGATTCTGAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail