Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7252
Gene name
Locationscaffold_69:13021..14959
Strand-
Gene length (bp)1938
Transcript length (bp)1797
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.9E-72 110 559
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-15 158 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 68 589 2.0E-101
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 68 590 7.0E-100
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 68 581 1.0E-99
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 68 590 1.0E-99
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 68 568 2.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 68 589 2.0E-101
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 68 590 7.0E-100
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 68 581 1.0E-99
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 68 590 1.0E-99
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 68 568 2.0E-99
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 81 568 5.0E-98
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 81 568 3.0E-97
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 65 569 6.0E-97
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 110 560 8.0E-25
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 159 556 3.0E-23
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 160 579 3.0E-22
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 163 559 3.0E-22
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 159 556 8.0E-22
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 164 557 2.0E-21
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 163 558 7.0E-21
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 160 576 2.0E-20
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 209 592 2.0E-20
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 177 574 3.0E-20
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 119 590 4.0E-20
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 119 559 8.0E-20
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 119 592 9.0E-20
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 209 560 1.0E-19
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 151 556 1.0E-19
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 200 587 1.0E-19
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 65 566 2.0E-19
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 110 555 2.0E-19
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 163 560 2.0E-19
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 209 562 2.0E-19
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 119 560 2.0E-19
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 93 570 4.0E-19
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 225 576 8.0E-19
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 134 579 8.0E-19
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 154 556 9.0E-19
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 153 558 1.0E-18
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 159 556 2.0E-18
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 119 559 3.0E-18
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 176 567 3.0E-18
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 209 562 4.0E-18
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 209 562 4.0E-18
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 149 450 4.0E-18
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 209 556 6.0E-18
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 154 556 1.0E-17
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 160 556 2.0E-17
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 209 572 4.0E-17
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 209 562 6.0E-17
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 160 577 7.0E-17
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 143 562 7.0E-17
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 141 579 8.0E-17
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 209 592 1.0E-16
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 110 592 1.0E-16
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 209 572 2.0E-16
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 209 572 2.0E-16
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 119 559 2.0E-16
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 106 570 3.0E-16
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 209 560 4.0E-16
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 93 587 4.0E-16
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 93 587 4.0E-16
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 93 587 4.0E-16
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 85 561 6.0E-16
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 119 563 7.0E-16
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 164 556 1.0E-15
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 128 560 1.0E-15
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 136 560 1.0E-15
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 206 598 1.0E-15
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 170 556 2.0E-15
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 181 558 2.0E-15
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 210 572 2.0E-15
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 128 559 2.0E-15
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 85 561 3.0E-15
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 159 560 3.0E-15
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 206 598 3.0E-15
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 93 587 3.0E-15
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 209 562 3.0E-15
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 170 549 4.0E-15
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 173 438 4.0E-15
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 160 559 5.0E-15
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 199 590 5.0E-15
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 148 560 6.0E-15
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 104 555 1.0E-14
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 110 567 1.0E-14
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 104 555 2.0E-14
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 200 587 2.0E-14
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 173 450 2.0E-14
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 206 562 2.0E-14
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 64 567 3.0E-14
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 160 556 4.0E-14
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 206 562 6.0E-14
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 107 555 6.0E-14
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 200 587 6.0E-14
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 156 569 7.0E-14
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 205 556 7.0E-14
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 111 558 8.0E-14
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 160 564 8.0E-14
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 111 585 9.0E-14
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 85 561 1.0E-13
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 160 556 1.0E-13
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 75 563 1.0E-13
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 133 560 2.0E-13
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 159 557 2.0E-13
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 133 560 3.0E-13
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 149 556 5.0E-13
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 28 574 7.0E-13
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 199 438 8.0E-13
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 93 587 9.0E-13
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 156 556 1.0E-12
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 145 560 1.0E-12
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 145 560 1.0E-12
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 212 587 1.0E-12
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 65 562 1.0E-12
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 93 560 2.0E-12
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 199 551 2.0E-12
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 150 560 2.0E-12
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 212 587 3.0E-12
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 201 558 3.0E-12
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 104 589 3.0E-12
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 212 587 3.0E-12
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 163 389 3.0E-12
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 153 550 3.0E-12
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 199 559 6.0E-12
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 77 558 6.0E-12
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 77 558 6.0E-12
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 212 587 7.0E-12
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 158 327 7.0E-12
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 110 550 7.0E-12
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 199 587 8.0E-12
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 212 587 8.0E-12
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 169 574 1.0E-11
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 119 560 1.0E-11
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 181 565 1.0E-11
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 212 587 1.0E-11
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 164 559 2.0E-11
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 149 567 3.0E-11
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 160 371 6.0E-11
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 164 579 8.0E-11
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 164 559 9.0E-11
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 160 442 9.0E-11
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 159 442 1.0E-10
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 199 559 1.0E-10
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 159 557 2.0E-10
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 158 426 2.0E-10
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 221 567 2.0E-10
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 149 488 3.0E-10
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 199 559 3.0E-10
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 182 426 3.0E-10
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 199 548 4.0E-10
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 102 482 4.0E-10
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 127 551 4.0E-10
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 195 560 5.0E-10
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 195 560 5.0E-10
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 127 551 6.0E-10
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 191 426 7.0E-10
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 199 549 7.0E-10
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 199 549 7.0E-10
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 199 549 1.0E-09
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 171 549 1.0E-09
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 107 575 1.0E-09
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 190 560 2.0E-09
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 159 442 2.0E-09
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 110 559 2.0E-09
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 104 555 3.0E-09
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 171 549 3.0E-09
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 158 560 3.0E-09
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 149 559 3.0E-09
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 201 561 4.0E-09
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 163 423 4.0E-09
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 199 549 4.0E-09
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 163 423 4.0E-09
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 163 422 4.0E-09
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 104 550 5.0E-09
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 179 494 5.0E-09
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 163 423 6.0E-09
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 171 549 7.0E-09
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 151 556 8.0E-09
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 171 556 8.0E-09
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 147 442 9.0E-09
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 158 560 1.0E-08
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 160 592 1.0E-08
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 164 488 1.0E-08
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 164 488 1.0E-08
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 139 442 2.0E-08
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 179 452 2.0E-08
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 160 549 2.0E-08
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 150 442 2.0E-08
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 160 556 2.0E-08
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 183 559 3.0E-08
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 171 549 3.0E-08
sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 139 445 3.0E-08
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 177 558 3.0E-08
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 146 495 7.0E-08
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 163 549 7.0E-08
sp|Q9R1U7|S22A8_RAT Solute carrier family 22 member 8 OS=Rattus norvegicus GN=Slc22a8 PE=1 SV=1 154 422 7.0E-08
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 164 488 9.0E-08
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 160 556 1.0E-07
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 139 442 1.0E-07
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 196 560 1.0E-07
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 139 442 2.0E-07
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 139 442 3.0E-07
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 159 444 3.0E-07
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 195 566 3.0E-07
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 159 481 3.0E-07
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 171 551 3.0E-07
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 143 439 3.0E-07
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 171 549 4.0E-07
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 153 446 5.0E-07
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 199 569 5.0E-07
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 171 549 5.0E-07
sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 163 441 5.0E-07
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 146 444 5.0E-07
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 101 560 6.0E-07
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 163 422 6.0E-07
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 101 559 1.0E-06
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 102 560 1.0E-06
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 128 567 1.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 179 589 1.0E-06
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 198 564 1.0E-06
sp|O88909|S22A8_MOUSE Solute carrier family 22 member 8 OS=Mus musculus GN=Slc22a8 PE=1 SV=2 154 422 1.0E-06
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 139 429 2.0E-06
sp|Q3ZAV1|S22AC_RAT Solute carrier family 22 member 12 OS=Rattus norvegicus GN=Slc22a12 PE=2 SV=1 142 367 2.0E-06
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 163 583 2.0E-06
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 159 444 2.0E-06
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 127 556 2.0E-06
sp|Q70BM6|S22A8_PIG Solute carrier family 22 member 8 OS=Sus scrofa GN=SLC22A8 PE=2 SV=1 163 422 3.0E-06
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 146 444 3.0E-06
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 209 556 4.0E-06
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 154 510 5.0E-06
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 157 442 5.0E-06
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 139 442 6.0E-06
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 158 327 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Transmembrane domain 0.0997 0.1306 0.0806 0.5373 0.0749 0.0048 0.21 0.3318 0.4591 0.0199

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 159 178 19
3 183 200 17
4 205 227 22
5 240 262 22
6 277 299 22
7 362 384 22
8 394 416 22
9 423 445 22
10 458 480 22
11 492 510 18
12 525 542 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup38
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1473
Ophiocordyceps australis 1348a (Ghana) OphauG2|683
Ophiocordyceps australis map64 (Brazil) OphauB2|1286
Ophiocordyceps australis map64 (Brazil) OphauB2|1397
Ophiocordyceps australis map64 (Brazil) OphauB2|5418
Ophiocordyceps camponoti-floridani Ophcf2|02934
Ophiocordyceps camponoti-floridani Ophcf2|06980
Ophiocordyceps camponoti-floridani Ophcf2|01832
Ophiocordyceps camponoti-floridani Ophcf2|02979
Ophiocordyceps camponoti-rufipedis Ophun1|1180
Ophiocordyceps camponoti-rufipedis Ophun1|1014
Ophiocordyceps camponoti-rufipedis Ophun1|7258
Ophiocordyceps camponoti-rufipedis Ophun1|2999
Ophiocordyceps kimflemingae Ophio5|1441
Ophiocordyceps kimflemingae Ophio5|3660
Ophiocordyceps kimflemingae Ophio5|7252 (this protein)
Ophiocordyceps kimflemingae Ophio5|8525
Ophiocordyceps subramaniannii Hirsu2|9948
Ophiocordyceps subramaniannii Hirsu2|6805
Ophiocordyceps subramaniannii Hirsu2|1776
Ophiocordyceps subramaniannii Hirsu2|10985

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7252
MAQKTAEIVLPSPDSPSVAPSEDAVGWDTNGGPTLGKLDVVTSLGNDESPFAKLRMMEECLWLSQKLESSDETNK
TRNDGETDKSLTFLQCCRKYPKALAWSGVLLMAIVMMAYSKLLIGAVISLPVFENKFGDKDPNDLADGHLIRPLW
QFALKDASLVAEIVGLMICGPLTGVIGYKKMMICSLAWTCIGVFPAVFAQNLATLLASQLICGLSWGVIEILAFM
YAAELVPSRLRAFVLSNVNTCWLLGQLLSTGVLTGLSSKKSDEVAIRLPFILQWVWAVPPLIAFFFLPESPWWLV
RRGRSSDARLSLRRLASKDSVDADVAVAMMKHTNKVEKRLNYGGARFRDMFKTKNRRRTEIACMIWICQALSGSS
ISSYAPYLMQRAGLDGSASITFSTIMYGIAIGGAICSLFVIQYVGRRTLYLWGLGSAVLFLTVAGIVSVVLPPSI
KVGWTLTALIIVTNLTYDLTIGPVCYVLVAEIPAMRLRLNTVALGRITYNVIKIISHIIMPKMANPTEWDWKGKV
CFVFAGTSLICLVWCYFRLPETKGLSHVELDILFELGAPAKKFSDFRKKLENTPYVSSADEQKNPWHGWLSYA
Coding >Ophio5|7252
ATGGCGCAGAAGACCGCTGAAATCGTCCTGCCTTCGCCAGATAGTCCCAGTGTGGCCCCCTCGGAAGATGCCGTC
GGCTGGGATACCAATGGCGGGCCAACGCTGGGGAAGCTGGACGTGGTGACGTCGCTGGGTAACGATGAGTCGCCG
TTCGCCAAGCTAAGGATGATGGAAGAGTGTCTCTGGCTATCGCAGAAGCTGGAGAGCTCCGACGAGACCAACAAG
ACGAGAAACGACGGGGAGACAGACAAGAGCTTGACATTTCTCCAATGCTGCCGCAAATACCCCAAGGCTCTCGCC
TGGTCGGGCGTGTTGCTAATGGCCATTGTCATGATGGCCTACAGCAAACTGCTCATCGGCGCCGTCATCTCTCTG
CCCGTCTTTGAGAATAAGTTTGGCGACAAAGACCCCAACGACTTGGCCGACGGCCATCTCATTCGGCCCTTGTGG
CAGTTCGCCCTCAAGGATGCTTCTCTGGTGGCCGAGATCGTCGGGTTAATGATTTGCGGTCCTCTCACGGGTGTC
ATCGGCTACAAGAAGATGATGATTTGCAGCTTGGCTTGGACCTGTATCGGTGTCTTCCCGGCCGTCTTTGCTCAA
AATCTTGCGACTCTGCTGGCGTCTCAACTCATCTGTGGCCTCTCATGGGGAGTCATCGAGATCCTCGCCTTCATG
TACGCGGCCGAGCTGGTCCCTTCTCGACTGCGCGCCTTTGTCCTCAGCAACGTTAATACGTGCTGGCTGCTTGGC
CAGCTCCTCTCCACCGGTGTCCTCACTGGCCTCAGTAGCAAAAAGTCGGACGAGGTGGCGATTCGCTTGCCGTTC
ATTCTTCAATGGGTCTGGGCAGTGCCTCCTCTCATCGCCTTCTTCTTCCTCCCGGAAAGCCCATGGTGGCTTGTA
CGTCGTGGTCGGTCCAGCGACGCCCGTCTCTCTCTCCGCCGGCTTGCGAGCAAGGATAGTGTCGATGCCGATGTT
GCCGTGGCCATGATGAAGCACACAAACAAGGTTGAGAAGAGGCTTAACTATGGCGGAGCCAGGTTCAGGGACATG
TTCAAGACCAAGAACCGACGCAGGACCGAAATCGCCTGCATGATTTGGATCTGCCAGGCTCTCTCCGGCAGCTCC
ATCTCCAGTTACGCACCCTATCTGATGCAGCGTGCTGGGCTGGACGGCTCGGCCTCCATCACCTTCTCGACCATA
ATGTACGGCATCGCCATTGGCGGCGCGATATGCTCACTATTCGTTATCCAGTACGTTGGCCGACGGACGCTCTAT
CTCTGGGGGCTCGGGTCAGCAGTCCTCTTTCTCACCGTCGCGGGTATCGTTTCCGTCGTCCTGCCTCCAAGCATC
AAAGTCGGTTGGACCTTGACCGCCCTCATCATCGTCACCAACTTAACCTACGACCTCACCATCGGACCCGTTTGC
TACGTTCTCGTAGCAGAAATTCCCGCCATGCGTCTCCGATTGAACACTGTCGCCCTGGGCAGGATCACTTATAAT
GTAATAAAGATTATAAGCCACATAATAATGCCTAAAATGGCCAACCCGACAGAGTGGGACTGGAAGGGCAAGGTC
TGTTTTGTCTTCGCGGGCACTTCTCTAATATGTCTCGTTTGGTGTTATTTCCGCTTGCCGGAGACAAAAGGACTC
TCCCATGTCGAGCTGGACATTCTCTTCGAGCTTGGAGCTCCGGCTAAGAAGTTCTCCGATTTTCGAAAGAAGCTG
GAAAATACGCCGTATGTCTCCAGCGCGGATGAGCAGAAAAACCCATGGCATGGATGGCTCTCATATGCA
Transcript >Ophio5|7252
ATGGCGCAGAAGACCGCTGAAATCGTCCTGCCTTCGCCAGATAGTCCCAGTGTGGCCCCCTCGGAAGATGCCGTC
GGCTGGGATACCAATGGCGGGCCAACGCTGGGGAAGCTGGACGTGGTGACGTCGCTGGGTAACGATGAGTCGCCG
TTCGCCAAGCTAAGGATGATGGAAGAGTGTCTCTGGCTATCGCAGAAGCTGGAGAGCTCCGACGAGACCAACAAG
ACGAGAAACGACGGGGAGACAGACAAGAGCTTGACATTTCTCCAATGCTGCCGCAAATACCCCAAGGCTCTCGCC
TGGTCGGGCGTGTTGCTAATGGCCATTGTCATGATGGCCTACAGCAAACTGCTCATCGGCGCCGTCATCTCTCTG
CCCGTCTTTGAGAATAAGTTTGGCGACAAAGACCCCAACGACTTGGCCGACGGCCATCTCATTCGGCCCTTGTGG
CAGTTCGCCCTCAAGGATGCTTCTCTGGTGGCCGAGATCGTCGGGTTAATGATTTGCGGTCCTCTCACGGGTGTC
ATCGGCTACAAGAAGATGATGATTTGCAGCTTGGCTTGGACCTGTATCGGTGTCTTCCCGGCCGTCTTTGCTCAA
AATCTTGCGACTCTGCTGGCGTCTCAACTCATCTGTGGCCTCTCATGGGGAGTCATCGAGATCCTCGCCTTCATG
TACGCGGCCGAGCTGGTCCCTTCTCGACTGCGCGCCTTTGTCCTCAGCAACGTTAATACGTGCTGGCTGCTTGGC
CAGCTCCTCTCCACCGGTGTCCTCACTGGCCTCAGTAGCAAAAAGTCGGACGAGGTGGCGATTCGCTTGCCGTTC
ATTCTTCAATGGGTCTGGGCAGTGCCTCCTCTCATCGCCTTCTTCTTCCTCCCGGAAAGCCCATGGTGGCTTGTA
CGTCGTGGTCGGTCCAGCGACGCCCGTCTCTCTCTCCGCCGGCTTGCGAGCAAGGATAGTGTCGATGCCGATGTT
GCCGTGGCCATGATGAAGCACACAAACAAGGTTGAGAAGAGGCTTAACTATGGCGGAGCCAGGTTCAGGGACATG
TTCAAGACCAAGAACCGACGCAGGACCGAAATCGCCTGCATGATTTGGATCTGCCAGGCTCTCTCCGGCAGCTCC
ATCTCCAGTTACGCACCCTATCTGATGCAGCGTGCTGGGCTGGACGGCTCGGCCTCCATCACCTTCTCGACCATA
ATGTACGGCATCGCCATTGGCGGCGCGATATGCTCACTATTCGTTATCCAGTACGTTGGCCGACGGACGCTCTAT
CTCTGGGGGCTCGGGTCAGCAGTCCTCTTTCTCACCGTCGCGGGTATCGTTTCCGTCGTCCTGCCTCCAAGCATC
AAAGTCGGTTGGACCTTGACCGCCCTCATCATCGTCACCAACTTAACCTACGACCTCACCATCGGACCCGTTTGC
TACGTTCTCGTAGCAGAAATTCCCGCCATGCGTCTCCGATTGAACACTGTCGCCCTGGGCAGGATCACTTATAAT
GTAATAAAGATTATAAGCCACATAATAATGCCTAAAATGGCCAACCCGACAGAGTGGGACTGGAAGGGCAAGGTC
TGTTTTGTCTTCGCGGGCACTTCTCTAATATGTCTCGTTTGGTGTTATTTCCGCTTGCCGGAGACAAAAGGACTC
TCCCATGTCGAGCTGGACATTCTCTTCGAGCTTGGAGCTCCGGCTAAGAAGTTCTCCGATTTTCGAAAGAAGCTG
GAAAATACGCCGTATGTCTCCAGCGCGGATGAGCAGAAAAACCCATGGCATGGATGGCTCTCATATGCATGA
Gene >Ophio5|7252
ATGGCGCAGAAGACCGCTGAAATCGTCCTGCCTTCGCCAGATAGTCCCAGTGTGGCCCCCTCGGAAGATGCCGTC
GGCTGGGATACCAATGGCGGGCCAACGCTGGGGAAGCTGGACGTGGTGACGTCGCTGGGTAACGATGAGTCGCCG
TTCGCCAAGCTAAGGATGATGGAAGAGTGTCTCTGGCTATCGCAGAAGCTGGAGAGCTCCGACGAGACCAACAAG
ACGAGAAACGACGGGGAGACAGACAAGAGCTTGACATTTCTCCAATGCTGCCGCAAATACCCCAAGGCTCTCGCC
TGGTCGGGCGTGTTGCTAATGGCCATTGTCATGATGGCCTACAGCAAACTGCTCATCGGCGCCGTCATCTCTCTG
CCCGTCTTTGAGAATAAGTTTGGCGACAAAGACCCCAACGACTTGGCCGACGGCCATCTCATTCGGCCCTTGTGG
CAGTTCGCCCTCAAGGATGCTTCTCTGGTGGCCGAGATCGTCGGGTTAATGATTTGCGGTCCTCTCACGGGTGTC
ATCGGCTACAAGAAGATGATGATTTGCAGCTTGGCTTGGACCTGTATCGGTGTCTTCCCGGCCGTCTTTGCTCAA
AATCTTGCGACTCTGCTGGCGTCTCAACTCATCTGTGGTTTGTGGCCTGTCTTTGCATCCCTCGAAAGCGTCTCC
GGCCTGACATTCTCTTCTCTACCCAGGCCTCTCATGGGGAGTCATCGAGATCCTCGCCTTCATGTACGCGGCCGA
GCTGGTCCCTTCTCGACTGCGCGCCTTTGTCCTCAGCAACGTTAATACGTGCTGGCTGCTTGGCCAGCTCCTCTC
CACCGGTGTCCTCACTGGCCTCAGTAGCAAAAAGTCGGACGAGGTGGCGATTCGCTTGCCGTTCATTCTTCAATG
GGTCTGGGCAGTGCCTCCTCTCATCGCCTTCTTCTTCCTCCCGGAAAGCCCATGTGAGATAAAATCACTCCCCCC
CGGACTCCACGTGCCGTCGACCGCCTGTCCAATTCTAACCTGGTCTTGTTTGCAGGGTGGCTTGTACGTCGTGGT
CGGTCCAGCGACGCCCGTCTCTCTCTCCGCCGGCTTGCGAGCAAGGATAGTGTCGATGCCGATGTTGCCGTGGCC
ATGATGAAGCACACAAACAAGGTTGAGAAGAGGCTTAACTATGGCGGAGCCAGGTTCAGGGACATGTTCAAGACC
AAGAACCGACGCAGGACCGAAATCGCCTGCATGATTTGGATCTGCCAGGCTCTCTCCGGCAGCTCCATCTCCAGT
TACGCACCCTATCTGATGCAGCGTGCTGGGCTGGACGGCTCGGCCTCCATCACCTTCTCGACCATAATGTACGGC
ATCGCCATTGGCGGCGCGATATGCTCACTATTCGTTATCCAGTACGTTGGCCGACGGACGCTCTATCTCTGGGGG
CTCGGGTCAGCAGTCCTCTTTCTCACCGTCGCGGGTATCGTTTCCGTCGTCCTGCCTCCAAGCATCAAAGTCGGT
TGGACCTTGACCGCCCTCATCATCGTCACCAACTTAACCTACGACCTCACCATCGGACCCGTTTGCTACGTTCTC
GTAGCAGAAATTCCCGCCATGCGTCTCCGATTGAACACTGTCGCCCTGGGCAGGATCACTTATAATGTAATAAAG
ATTATAAGCCACATAATAATGCCTAAAATGGCCAACCCGACAGAGTGGGACTGGAAGGGCAAGGTCTGTTTTGTC
TTCGCGGGCACTTCTCTAATATGTCTCGTTTGGTGTTATTTCCGCTTGCCGGAGACAAAAGGACTCTCCCATGTC
GAGCTGGACATTCTCTTCGAGCTTGGAGCTCCGGCTAAGAAGTTCTCCGATTTTCGAAAGAAGCTGGAAAATACG
CCGTATGTCTCCAGCGCGGATGAGCAGAAAAACCCATGGCATGGATGGCTCTCATATGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail