Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7246
Gene name
Locationscaffold_688:7562..9246
Strand+
Gene length (bp)1684
Transcript length (bp)1605
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 1.9E-15 323 499

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38705|SYSM_YEAST Serine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIA4 PE=1 SV=1 224 525 5.0E-70
sp|Q8RWT8|SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA7 PE=2 SV=1 33 525 2.0E-56
sp|Q9JJL8|SYSM_MOUSE Serine--tRNA ligase, mitochondrial OS=Mus musculus GN=Sars2 PE=1 SV=2 146 533 4.0E-54
sp|Q9N0F3|SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus GN=SARS2 PE=1 SV=1 8 533 1.0E-53
sp|Q9UTB2|SYSM_SCHPO Serine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dia4 PE=3 SV=2 30 520 1.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38705|SYSM_YEAST Serine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIA4 PE=1 SV=1 224 525 5.0E-70
sp|Q8RWT8|SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA7 PE=2 SV=1 33 525 2.0E-56
sp|Q9JJL8|SYSM_MOUSE Serine--tRNA ligase, mitochondrial OS=Mus musculus GN=Sars2 PE=1 SV=2 146 533 4.0E-54
sp|Q9N0F3|SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus GN=SARS2 PE=1 SV=1 8 533 1.0E-53
sp|Q9UTB2|SYSM_SCHPO Serine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dia4 PE=3 SV=2 30 520 1.0E-53
sp|Q9NP81|SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens GN=SARS2 PE=1 SV=1 146 533 4.0E-53
sp|Q1AX26|SYS_RUBXD Serine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=serS PE=3 SV=1 35 531 4.0E-51
sp|Q7UXX6|SYS_RHOBA Serine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=serS PE=3 SV=2 35 519 5.0E-51
sp|A1SD34|SYS_NOCSJ Serine--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=serS PE=3 SV=1 98 519 2.0E-47
sp|Q73KB2|SYS_TREDE Serine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=serS PE=3 SV=1 114 526 4.0E-47
sp|Q6KZN5|SYS_PICTO Serine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=serS PE=3 SV=1 35 527 1.0E-45
sp|B2GF13|SYS_LACF3 Serine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=serS PE=3 SV=1 136 534 2.0E-45
sp|B2S3N6|SYS_TREPS Serine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=serS PE=3 SV=1 225 518 9.0E-45
sp|O83653|SYS_TREPA Serine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=serS PE=3 SV=1 225 518 9.0E-45
sp|Q82FK8|SYS1_STRAW Serine--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=serS1 PE=3 SV=1 113 521 5.0E-44
sp|Q6A5P0|SYS_PROAC Serine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=serS PE=3 SV=1 132 525 7.0E-44
sp|Q9ZBX1|SYS_STRCO Serine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=serS PE=3 SV=1 113 521 2.0E-43
sp|Q9HKX5|SYS_THEAC Serine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=serS PE=3 SV=1 35 518 1.0E-42
sp|B2G575|SYS_LACRJ Serine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=serS PE=3 SV=1 231 533 1.0E-42
sp|A5VHP5|SYS_LACRD Serine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=serS PE=3 SV=1 231 533 1.0E-42
sp|Q1WVB3|SYS_LACS1 Serine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=serS PE=3 SV=1 35 525 9.0E-42
sp|B1VP80|SYS_STRGG Serine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=serS PE=3 SV=1 113 521 9.0E-41
sp|Q88Z60|SYS1_LACPL Serine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serS1 PE=3 SV=1 103 525 9.0E-41
sp|Q39PU1|SYS_GEOMG Serine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=serS PE=3 SV=1 35 526 1.0E-40
sp|Q9Z736|SYS_CHLPN Serine--tRNA ligase OS=Chlamydia pneumoniae GN=serS PE=3 SV=1 143 522 2.0E-40
sp|A5CNA2|SYS_CLAM3 Serine--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=serS PE=3 SV=1 145 522 2.0E-40
sp|A0LWR6|SYS_ACIC1 Serine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=serS PE=3 SV=1 172 519 4.0E-40
sp|A0RTS8|SYS_CENSY Serine--tRNA ligase OS=Cenarchaeum symbiosum (strain A) GN=serS PE=3 SV=1 142 519 4.0E-40
sp|Q821P2|SYS_CHLCV Serine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=serS PE=3 SV=1 143 519 4.0E-40
sp|A0JR71|SYS_ARTS2 Serine--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=serS PE=3 SV=1 96 522 5.0E-40
sp|Q0SNT6|SYS_BORAP Serine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=serS PE=3 SV=1 35 518 5.0E-40
sp|Q5FIN5|SYS_LACAC Serine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=serS PE=3 SV=1 130 530 1.0E-39
sp|B2KEV5|SYS_ELUMP Serine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=serS PE=3 SV=1 225 519 1.0E-39
sp|Q662D8|SYS_BORBP Serine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=serS PE=3 SV=1 35 518 2.0E-39
sp|Q88XZ7|SYS2_LACPL Serine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serS2 PE=3 SV=1 145 529 2.0E-39
sp|A8YWU9|SYS_LACH4 Serine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=serS PE=3 SV=1 130 530 2.0E-39
sp|Q5NNV0|SYS_ZYMMO Serine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=serS PE=3 SV=1 103 525 3.0E-39
sp|Q255Z9|SYS_CHLFF Serine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=serS PE=3 SV=1 119 519 4.0E-39
sp|B1MW28|SYS_LEUCK Serine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=serS PE=3 SV=1 89 525 4.0E-39
sp|Q8FLY5|SYS_COREF Serine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=serS PE=3 SV=2 231 519 4.0E-39
sp|Q83FJ7|SYS_TROWT Serine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=serS PE=3 SV=1 163 519 5.0E-39
sp|B0RCF1|SYS_CLAMS Serine--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=serS PE=3 SV=1 145 522 5.0E-39
sp|Q83HA1|SYS_TROW8 Serine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=serS PE=3 SV=1 163 519 5.0E-39
sp|Q5L4Z0|SYS_CHLAB Serine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=serS PE=3 SV=1 143 521 5.0E-39
sp|B4UFJ8|SYS_ANASK Serine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=serS PE=3 SV=1 119 525 7.0E-39
sp|B8H9Q1|SYS_ARTCA Serine--tRNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=serS PE=3 SV=1 96 522 8.0E-39
sp|Q0W8S5|SYS_METAR Serine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=serS PE=3 SV=1 92 522 9.0E-39
sp|B7J1F4|SYS_BORBZ Serine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=serS PE=3 SV=1 35 518 9.0E-39
sp|O51244|SYS_BORBU Serine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=serS PE=3 SV=1 35 518 9.0E-39
sp|Q979Z3|SYS_THEVO Serine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=serS PE=3 SV=1 35 518 1.0E-38
sp|A9A4V3|SYS_NITMS Serine--tRNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=serS PE=3 SV=1 82 525 2.0E-38
sp|B8J8M9|SYS_ANAD2 Serine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=serS PE=3 SV=1 119 525 2.0E-38
sp|B0K0Z5|SYS_THEPX Serine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=serS PE=3 SV=1 231 519 3.0E-38
sp|B0KAI8|SYS_THEP3 Serine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=serS PE=3 SV=1 231 519 3.0E-38
sp|B1I161|SYS_DESAP Serine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=serS PE=3 SV=1 140 525 3.0E-38
sp|C3MBU2|SYS_RHISN Serine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=serS PE=3 SV=1 121 525 3.0E-38
sp|Q8NLP6|SYS_CORGL Serine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=serS PE=3 SV=1 231 519 4.0E-38
sp|Q8RDJ5|SYS_CALS4 Serine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=serS PE=3 SV=1 231 519 5.0E-38
sp|Q74HZ5|SYS_LACJO Serine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=serS PE=3 SV=1 131 525 5.0E-38
sp|Q0B0Y5|SYS_SYNWW Serine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=serS PE=3 SV=1 35 528 8.0E-38
sp|Q3ZWY0|SYS_DEHMC Serine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=serS PE=3 SV=1 35 519 8.0E-38
sp|A5FRN4|SYS_DEHMB Serine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=serS PE=3 SV=1 35 519 8.0E-38
sp|Q041F5|SYS_LACGA Serine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=serS PE=3 SV=1 131 525 9.0E-38
sp|Q9PLJ7|SYS_CHLMU Serine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=serS PE=3 SV=1 225 521 1.0E-37
sp|C0QLD3|SYS_DESAH Serine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=serS PE=3 SV=1 80 525 1.0E-37
sp|A3CTP4|SYS_METMJ Serine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=serS PE=3 SV=1 233 521 2.0E-37
sp|C5C878|SYS_MICLC Serine--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=serS PE=3 SV=1 103 525 2.0E-37
sp|C4LGQ1|SYS_CORK4 Serine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=serS PE=3 SV=1 157 519 2.0E-37
sp|B5E8F6|SYS_GEOBB Serine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=serS PE=3 SV=1 139 525 2.0E-37
sp|A7HN78|SYS_FERNB Serine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=serS PE=3 SV=1 35 519 2.0E-37
sp|Q2IGB1|SYS_ANADE Serine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=serS PE=3 SV=1 144 525 2.0E-37
sp|A7HZX6|SYS_CAMHC Serine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=serS PE=3 SV=1 89 519 2.0E-37
sp|Q839Q8|SYS1_ENTFA Serine--tRNA ligase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS1 PE=3 SV=1 35 525 3.0E-37
sp|Q74H55|SYS_GEOSL Serine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=serS PE=3 SV=1 35 526 5.0E-37
sp|Q03ZQ9|SYS_LEUMM Serine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=serS PE=3 SV=1 141 525 8.0E-37
sp|A7I890|SYS_METB6 Serine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=serS PE=3 SV=1 232 520 9.0E-37
sp|Q18FL9|SYS_HALWD Serine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=serS PE=3 SV=1 141 527 1.0E-36
sp|Q38UM4|SYS_LACSS Serine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=serS PE=3 SV=1 35 526 1.0E-36
sp|B3DX68|SYS_METI4 Serine--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=serS PE=3 SV=1 140 519 1.0E-36
sp|C6E7Z3|SYS_GEOSM Serine--tRNA ligase OS=Geobacter sp. (strain M21) GN=serS PE=3 SV=1 139 525 1.0E-36
sp|Q03PU5|SYS_LACBA Serine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=serS PE=3 SV=1 116 525 1.0E-36
sp|O81983|SYS_HELAN Serine--tRNA ligase OS=Helianthus annuus PE=2 SV=1 227 521 2.0E-36
sp|Q6AH61|SYS_LEIXX Serine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=serS PE=3 SV=1 132 522 2.0E-36
sp|Q048F6|SYS_LACDB Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=serS PE=3 SV=1 139 525 2.0E-36
sp|Q1G8N2|SYS_LACDA Serine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=serS PE=3 SV=1 139 525 2.0E-36
sp|O84734|SYS_CHLTR Serine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=serS PE=3 SV=1 225 521 2.0E-36
sp|Q3KKW5|SYS_CHLTA Serine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=serS PE=3 SV=1 225 521 2.0E-36
sp|B0TAQ9|SYS_HELMI Serine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=serS PE=3 SV=1 226 527 2.0E-36
sp|B0BAI4|SYS_CHLTB Serine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=serS PE=3 SV=1 225 521 3.0E-36
sp|B0B8V5|SYS_CHLT2 Serine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=serS PE=3 SV=1 225 521 3.0E-36
sp|A8I4J4|SYS_AZOC5 Serine--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=serS PE=3 SV=1 143 525 3.0E-36
sp|Q39230|SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At5g27470 PE=2 SV=1 232 521 3.0E-36
sp|B2GGG9|SYS_KOCRD Serine--tRNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=serS PE=3 SV=1 170 521 3.0E-36
sp|Q9HNJ8|SYS_HALSA Serine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=serS PE=3 SV=2 234 527 3.0E-36
sp|B0R6Z8|SYS_HALS3 Serine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=serS PE=3 SV=1 234 527 3.0E-36
sp|B8FXX3|SYS_DESHD Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=serS PE=3 SV=1 140 526 3.0E-36
sp|O66647|SYS_AQUAE Serine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=serS PE=1 SV=1 231 519 4.0E-36
sp|A9IS21|SYS_BART1 Serine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=serS PE=3 SV=1 35 525 5.0E-36
sp|Q92Q22|SYS_RHIME Serine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=serS PE=3 SV=1 119 525 6.0E-36
sp|Q89L00|SYS_BRADU Serine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=serS PE=3 SV=1 231 525 6.0E-36
sp|A1R120|SYS_ARTAT Serine--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=serS PE=3 SV=1 96 522 7.0E-36
sp|A7GWY9|SYS_CAMC5 Serine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=serS PE=3 SV=1 166 519 7.0E-36
sp|A3Q7P6|SYS_MYCSJ Serine--tRNA ligase OS=Mycobacterium sp. (strain JLS) GN=serS PE=3 SV=1 213 519 7.0E-36
sp|Q1B1V1|SYS_MYCSS Serine--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=serS PE=3 SV=1 213 519 8.0E-36
sp|A1UN98|SYS_MYCSK Serine--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=serS PE=3 SV=1 213 519 8.0E-36
sp|B2J6K8|SYS_NOSP7 Serine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=serS PE=3 SV=1 35 519 8.0E-36
sp|Q1DAZ4|SYS_MYXXD Serine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=serS PE=3 SV=1 231 525 8.0E-36
sp|B3CQX9|SYS_ORITI Serine--tRNA ligase OS=Orientia tsutsugamushi (strain Ikeda) GN=serS PE=3 SV=1 121 525 8.0E-36
sp|Q2RMH8|SYS_MOOTA Serine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=serS PE=3 SV=1 231 525 9.0E-36
sp|B5RL50|SYS_BORDL Serine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=serS PE=3 SV=1 35 518 1.0E-35
sp|Q252J5|SYS_DESHY Serine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=serS PE=3 SV=1 140 526 1.0E-35
sp|A6U8N8|SYS_SINMW Serine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=serS PE=3 SV=1 119 525 1.0E-35
sp|A9BEX3|SYS_PETMO Serine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=serS PE=3 SV=1 231 526 2.0E-35
sp|C5A226|SYS_THEGJ Serine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=serS PE=3 SV=1 35 525 2.0E-35
sp|A2SRC6|SYS_METLZ Serine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=serS PE=3 SV=1 232 525 2.0E-35
sp|A5D6D5|SYS_PELTS Serine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=serS PE=3 SV=1 231 526 2.0E-35
sp|A4YV70|SYS_BRASO Serine--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=serS PE=3 SV=1 143 525 2.0E-35
sp|Q57DM2|SYS_BRUAB Serine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=serS PE=3 SV=1 84 525 2.0E-35
sp|Q2YNM6|SYS_BRUA2 Serine--tRNA ligase OS=Brucella abortus (strain 2308) GN=serS PE=3 SV=1 84 525 2.0E-35
sp|B2S5B8|SYS_BRUA1 Serine--tRNA ligase OS=Brucella abortus (strain S19) GN=serS PE=3 SV=1 84 525 2.0E-35
sp|A5GD47|SYS_GEOUR Serine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=serS PE=3 SV=1 131 525 3.0E-35
sp|B3W8V7|SYS_LACCB Serine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=serS PE=3 SV=1 225 525 3.0E-35
sp|A6LJM6|SYS_THEM4 Serine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=serS PE=3 SV=1 35 525 4.0E-35
sp|C1B914|SYS_RHOOB Serine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=serS PE=3 SV=1 132 519 4.0E-35
sp|A5EJV9|SYS_BRASB Serine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=serS PE=3 SV=1 143 525 5.0E-35
sp|B1ZJ12|SYS_METPB Serine--tRNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=serS PE=3 SV=1 232 528 5.0E-35
sp|A9HLG2|SYS_GLUDA Serine--tRNA ligase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=serS PE=3 SV=1 119 525 5.0E-35
sp|Q037M7|SYS_LACC3 Serine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=serS PE=3 SV=1 225 525 5.0E-35
sp|Q8YGS6|SYS_BRUME Serine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=serS PE=3 SV=2 84 525 5.0E-35
sp|C0RIL8|SYS_BRUMB Serine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=serS PE=3 SV=1 84 525 5.0E-35
sp|B8E0R9|SYS_DICTD Serine--tRNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=serS PE=3 SV=1 35 519 5.0E-35
sp|A4J0G4|SYS_DESRM Serine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=serS PE=3 SV=1 228 525 6.0E-35
sp|B9LQZ7|SYS_HALLT Serine--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=serS PE=3 SV=1 234 527 6.0E-35
sp|B7KPY5|SYS_METC4 Serine--tRNA ligase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=serS PE=3 SV=1 140 528 6.0E-35
sp|Q03EA5|SYS_PEDPA Serine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=serS PE=3 SV=1 143 526 6.0E-35
sp|B9L131|SYS_THERP Serine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=serS PE=3 SV=1 117 526 7.0E-35
sp|B9MQM8|SYS_CALBD Serine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=serS PE=3 SV=1 115 519 7.0E-35
sp|A7HXK4|SYS_PARL1 Serine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=serS PE=3 SV=1 125 529 7.0E-35
sp|Q47TZ5|SYS_THEFY Serine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=serS PE=3 SV=1 123 519 8.0E-35
sp|B2IJG1|SYS_BEII9 Serine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=serS PE=3 SV=1 85 525 1.0E-34
sp|A4XJH1|SYS_CALS8 Serine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=serS PE=3 SV=1 121 519 1.0E-34
sp|Q8G139|SYS_BRUSU Serine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=serS PE=3 SV=1 84 525 1.0E-34
sp|B0CLL0|SYS_BRUSI Serine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=serS PE=3 SV=1 84 525 1.0E-34
sp|A9MAQ8|SYS_BRUC2 Serine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=serS PE=3 SV=1 84 525 1.0E-34
sp|Q02XG6|SYS_LACLS Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=serS PE=3 SV=1 114 525 1.0E-34
sp|Q3Z8Y0|SYS_DEHM1 Serine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=serS PE=3 SV=1 35 519 1.0E-34
sp|A2RJ76|SYS_LACLM Serine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=serS PE=3 SV=1 114 525 1.0E-34
sp|A9VY49|SYS_METEP Serine--tRNA ligase OS=Methylobacterium extorquens (strain PA1) GN=serS PE=3 SV=1 140 528 1.0E-34
sp|Q11HC8|SYS_CHESB Serine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=serS PE=3 SV=1 121 529 1.0E-34
sp|Q3A8Q5|SYS_CARHZ Serine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=serS PE=3 SV=1 144 525 1.0E-34
sp|A0RQK5|SYS_CAMFF Serine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=serS PE=3 SV=1 130 519 2.0E-34
sp|Q2W4A0|SYS_MAGSA Serine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=serS PE=3 SV=1 143 526 2.0E-34
sp|B7IFW4|SYS_THEAB Serine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=serS PE=3 SV=1 35 525 2.0E-34
sp|Q9CEX2|SYS_LACLA Serine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=serS PE=3 SV=1 114 525 2.0E-34
sp|B8DW52|SYS_BIFA0 Serine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=serS PE=3 SV=1 231 525 2.0E-34
sp|Q9YAG3|SYS_AERPE Serine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=serS PE=3 SV=2 135 524 2.0E-34
sp|Q6NEN2|SYS_CORDI Serine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=serS PE=3 SV=1 231 519 3.0E-34
sp|A5CDU5|SYS_ORITB Serine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=serS PE=3 SV=1 135 525 3.0E-34
sp|B6YWW5|SYS_THEON Serine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=serS PE=3 SV=1 35 525 3.0E-34
sp|Q0AND9|SYS_MARMM Serine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=serS PE=3 SV=1 231 527 4.0E-34
sp|C0ZH54|SYS_BREBN Serine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=serS PE=3 SV=1 166 526 4.0E-34
sp|A1BHA5|SYS_CHLPD Serine--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=serS PE=3 SV=1 35 518 4.0E-34
sp|Q2KWF5|SYS_BORA1 Serine--tRNA ligase OS=Bordetella avium (strain 197N) GN=serS PE=3 SV=1 145 525 4.0E-34
sp|B8CZZ9|SYS_HALOH Serine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=serS PE=3 SV=1 115 525 5.0E-34
sp|A1ALM7|SYS_PELPD Serine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=serS PE=3 SV=1 231 525 5.0E-34
sp|A2BXQ6|SYS_PROM5 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=serS PE=3 SV=1 35 519 5.0E-34
sp|B4RDI1|SYS_PHEZH Serine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=serS PE=3 SV=1 231 527 6.0E-34
sp|A1TGX4|SYS_MYCVP Serine--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=serS PE=3 SV=1 224 519 7.0E-34
sp|B5ZMG0|SYS_RHILW Serine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=serS PE=3 SV=1 95 525 8.0E-34
sp|C6A4A3|SYS_THESM Serine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=serS PE=3 SV=1 35 525 8.0E-34
sp|C5BWI5|SYS_BEUC1 Serine--tRNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=serS PE=3 SV=1 167 522 8.0E-34
sp|Q2RTH5|SYS_RHORT Serine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=serS PE=3 SV=1 141 526 8.0E-34
sp|O28244|SYS_ARCFU Serine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=serS PE=3 SV=1 121 519 8.0E-34
sp|Q8YQ59|SYS_NOSS1 Serine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=serS PE=3 SV=1 35 519 8.0E-34
sp|B1L5G0|SYS_KORCO Serine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=serS PE=3 SV=1 77 520 1.0E-33
sp|B9M3Q9|SYS_GEODF Serine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=serS PE=3 SV=1 35 526 1.0E-33
sp|Q136H4|SYS_RHOPS Serine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=serS PE=3 SV=1 129 525 1.0E-33
sp|C4L937|SYS_TOLAT Serine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=serS PE=3 SV=1 119 526 1.0E-33
sp|Q5JE75|SYS_THEKO Serine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=serS PE=3 SV=1 174 525 2.0E-33
sp|Q8U1K2|SYS_PYRFU Serine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=serS PE=3 SV=1 174 525 2.0E-33
sp|Q4FM02|SYS_PELUB Serine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=serS PE=3 SV=1 120 525 2.0E-33
sp|Q2K967|SYS_RHIEC Serine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=serS PE=3 SV=1 146 525 2.0E-33
sp|A9IGG4|SYS_BORPD Serine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=serS PE=3 SV=1 142 522 3.0E-33
sp|B6JFP3|SYS_OLICO Serine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=serS PE=3 SV=1 131 525 3.0E-33
sp|O58441|SYS_PYRHO Serine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=serS PE=1 SV=2 35 525 3.0E-33
sp|Q04GM3|SYS_OENOB Serine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=serS PE=3 SV=1 35 531 3.0E-33
sp|B8IN20|SYS_METNO Serine--tRNA ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=serS PE=3 SV=1 232 528 3.0E-33
sp|B1YGC4|SYS_EXIS2 Serine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=serS PE=3 SV=1 141 527 3.0E-33
sp|A1A0B7|SYS_BIFAA Serine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=serS PE=3 SV=1 231 525 3.0E-33
sp|Q316Z9|SYS_DESAG Serine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=serS PE=3 SV=1 224 522 4.0E-33
sp|B0UD12|SYS_METS4 Serine--tRNA ligase OS=Methylobacterium sp. (strain 4-46) GN=serS PE=3 SV=1 232 528 4.0E-33
sp|A7ZBR7|SYS_CAMC1 Serine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=serS PE=3 SV=1 166 519 4.0E-33
sp|P26638|SYSC_MOUSE Serine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Sars PE=1 SV=3 233 519 4.0E-33
sp|A3DI04|SYS_CLOTH Serine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=serS PE=3 SV=1 231 525 4.0E-33
sp|Q30PY7|SYS_SULDN Serine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=serS PE=3 SV=1 167 520 5.0E-33
sp|Q5PAH7|SYS_ANAMM Serine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=serS PE=3 SV=2 232 518 6.0E-33
sp|C4KZX8|SYS_EXISA Serine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=serS PE=3 SV=1 130 529 6.0E-33
sp|A4YI40|SYS_METS5 Serine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=serS PE=3 SV=1 83 524 6.0E-33
sp|B9JEH1|SYS_AGRRK Serine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=serS PE=3 SV=1 84 525 8.0E-33
sp|Q6P799|SYSC_RAT Serine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Sars PE=1 SV=3 233 519 8.0E-33
sp|P54221|SYS_HALMA Serine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=serS PE=1 SV=1 100 527 8.0E-33
sp|Q2NEU9|SYS_METST Serine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=serS PE=3 SV=1 225 521 9.0E-33
sp|Q6F2A0|SYS_MESFL Serine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=serS PE=3 SV=1 115 525 9.0E-33
sp|A0K5F5|SYS_BURCH Serine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=serS PE=3 SV=1 232 528 1.0E-32
sp|Q0S9E8|SYS_RHOJR Serine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=serS PE=3 SV=1 132 519 1.0E-32
sp|B3PXU3|SYS_RHIE6 Serine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=serS PE=3 SV=1 129 525 1.0E-32
sp|B7JY63|SYS_CYAP8 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=serS PE=3 SV=1 35 519 1.0E-32
sp|Q9UZ21|SYS_PYRAB Serine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=serS PE=3 SV=1 231 525 1.0E-32
sp|A0LI63|SYS_SYNFM Serine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=serS PE=3 SV=1 35 525 1.0E-32
sp|A2BM70|SYS_HYPBU Serine--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=serS PE=3 SV=1 89 519 1.0E-32
sp|B4EBR4|SYS_BURCJ Serine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=serS PE=3 SV=1 232 528 2.0E-32
sp|A8ZXS1|SYS_DESOH Serine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=serS PE=3 SV=1 161 522 2.0E-32
sp|Q6YRD2|SYS_ONYPE Serine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=serS PE=3 SV=1 121 519 2.0E-32
sp|Q5FGY8|SYS_EHRRG Serine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=serS PE=3 SV=1 230 521 2.0E-32
sp|Q3MCE0|SYS_ANAVT Serine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=serS PE=3 SV=1 35 519 2.0E-32
sp|B1JX98|SYS_BURCC Serine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=serS PE=3 SV=1 232 528 2.0E-32
sp|Q2FS27|SYS_METHJ Serine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=serS PE=3 SV=1 232 520 2.0E-32
sp|B1Y0I6|SYS_LEPCP Serine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=serS PE=3 SV=1 149 522 2.0E-32
sp|Q9RUV5|SYS_DEIRA Serine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=serS PE=3 SV=1 231 528 2.0E-32
sp|Q0BSQ2|SYS_GRABC Serine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=serS PE=3 SV=1 232 525 3.0E-32
sp|A6TJ99|SYS_ALKMQ Serine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=serS PE=3 SV=1 140 525 3.0E-32
sp|A7H4Y8|SYS_CAMJD Serine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=serS PE=3 SV=1 166 519 3.0E-32
sp|Q2SJB8|SYS_HAHCH Serine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=serS PE=3 SV=1 231 525 3.0E-32
sp|Q9PIB3|SYS_CAMJE Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=serS PE=3 SV=1 75 519 4.0E-32
sp|B3Q6H9|SYS_RHOPT Serine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=serS PE=3 SV=1 224 525 4.0E-32
sp|Q6N5X5|SYS_RHOPA Serine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=serS PE=3 SV=1 224 525 4.0E-32
sp|A8GTQ7|SYS_RICRS Serine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=serS PE=3 SV=1 232 525 4.0E-32
sp|B0BV96|SYS_RICRO Serine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=serS PE=3 SV=1 232 525 4.0E-32
sp|Q3BUY8|SYS_XANC5 Serine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=serS PE=3 SV=1 119 526 4.0E-32
sp|Q8G3W7|SYS_BIFLO Serine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=serS PE=3 SV=1 231 525 4.0E-32
sp|A7INN1|SYS_XANP2 Serine--tRNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=serS PE=3 SV=1 142 525 5.0E-32
sp|A9AES3|SYS_BURM1 Serine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=serS PE=3 SV=1 232 528 5.0E-32
sp|Q9AEN2|SYS_BURCE Serine--tRNA ligase OS=Burkholderia cepacia GN=serS PE=3 SV=1 232 528 5.0E-32
sp|Q820S5|SYS_NITEU Serine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=serS PE=3 SV=1 145 526 5.0E-32
sp|Q5HW78|SYS_CAMJR Serine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=serS PE=3 SV=1 75 519 6.0E-32
sp|Q6MRK1|SYS_BDEBA Serine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=serS PE=3 SV=1 137 525 6.0E-32
sp|A1KV93|SYS_NEIMF Serine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=serS PE=3 SV=1 142 525 6.0E-32
sp|Q9GMB8|SYSC_BOVIN Serine--tRNA ligase, cytoplasmic OS=Bos taurus GN=SARS PE=2 SV=3 233 519 7.0E-32
sp|A1US81|SYS_BARBK Serine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=serS PE=3 SV=1 35 525 7.0E-32
sp|B3DQG7|SYS_BIFLD Serine--tRNA ligase OS=Bifidobacterium longum (strain DJO10A) GN=serS PE=3 SV=1 231 525 7.0E-32
sp|B5YEY8|SYS_DICT6 Serine--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=serS PE=3 SV=1 35 519 7.0E-32
sp|Q8KES6|SYS_CHLTE Serine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=serS PE=3 SV=1 230 518 7.0E-32
sp|Q024V4|SYS_SOLUE Serine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=serS PE=3 SV=1 231 520 7.0E-32
sp|A5FX43|SYS_ACICJ Serine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=serS PE=3 SV=1 225 526 8.0E-32
sp|B1GZ25|SYS_UNCTG Serine--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=serS PE=3 SV=1 35 518 9.0E-32
sp|B0BYR8|SYS_ACAM1 Serine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=serS PE=3 SV=1 35 519 1.0E-31
sp|C3PLR3|SYS_RICAE Serine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=serS PE=3 SV=1 198 525 1.0E-31
sp|P57836|SYS_PASMU Serine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=serS PE=3 SV=1 143 526 1.0E-31
sp|Q1IZU9|SYS_DEIGD Serine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=serS PE=3 SV=1 230 528 1.0E-31
sp|B5EMC5|SYS_ACIF5 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=serS PE=3 SV=1 152 525 1.0E-31
sp|B7J4C9|SYS_ACIF2 Serine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=serS PE=3 SV=1 152 525 1.0E-31
sp|Q87ZS9|SYS_PSESM Serine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=serS PE=3 SV=1 119 526 1.0E-31
sp|B8ELG9|SYS_METSB Serine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=serS PE=3 SV=1 224 528 1.0E-31
sp|Q6GKT6|SYS_STAAR Serine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=serS PE=3 SV=1 119 528 1.0E-31
sp|P37464|SYS_BACSU Serine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=serS PE=3 SV=1 133 528 1.0E-31
sp|Q3KA84|SYS_PSEPF Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=serS PE=3 SV=1 119 526 1.0E-31
sp|A4JCA3|SYS_BURVG Serine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=serS PE=3 SV=1 232 528 2.0E-31
sp|Q48H74|SYS_PSE14 Serine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=serS PE=3 SV=1 119 526 2.0E-31
sp|P99178|SYS_STAAN Serine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=serS PE=1 SV=1 119 528 2.0E-31
sp|P61083|SYS_STAAM Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|A5INQ0|SYS_STAA9 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|A6TXF9|SYS_STAA2 Serine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|A7WWP0|SYS_STAA1 Serine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|Q4ZRL5|SYS_PSEU2 Serine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=serS PE=3 SV=1 119 526 2.0E-31
sp|C4K208|SYS_RICPU Serine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=serS PE=3 SV=1 198 525 2.0E-31
sp|B7GN83|SYS_BIFLS Serine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=serS PE=3 SV=1 103 525 2.0E-31
sp|Q92GA7|SYS_RICCN Serine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=serS PE=3 SV=1 198 525 2.0E-31
sp|A1VYA9|SYS_CAMJJ Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=serS PE=3 SV=1 198 519 2.0E-31
sp|Q6G419|SYS_BARHE Serine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=serS PE=3 SV=1 146 525 2.0E-31
sp|Q9KGN4|SYS_BACHD Serine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=serS PE=3 SV=1 231 525 2.0E-31
sp|B3QM90|SYS_CHLP8 Serine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=serS PE=3 SV=1 230 518 2.0E-31
sp|B8DQP8|SYS_DESVM Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=serS PE=3 SV=1 231 525 2.0E-31
sp|Q4R4U9|SYSC_MACFA Serine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=SARS PE=2 SV=3 233 519 2.0E-31
sp|Q5HB76|SYS_EHRRW Serine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=serS PE=3 SV=1 230 521 2.0E-31
sp|Q8GMR7|SYS_SYNE7 Serine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=serS PE=3 SV=4 144 519 2.0E-31
sp|Q2GA28|SYS_NOVAD Serine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=serS PE=3 SV=1 82 525 2.0E-31
sp|Q8NYY2|SYS_STAAW Serine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|Q8RH11|SYS_FUSNN Serine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=serS PE=3 SV=2 231 525 2.0E-31
sp|B0U3G5|SYS_XYLFM Serine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=serS PE=3 SV=1 119 526 2.0E-31
sp|A8YYT2|SYS_STAAT Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|A6QD48|SYS_STAAE Serine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|Q5HJY7|SYS_STAAC Serine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|P95689|SYS_STAA8 Serine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|Q2FKP7|SYS_STAA3 Serine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=serS PE=3 SV=1 119 528 2.0E-31
sp|B3ENZ9|SYS_CHLPB Serine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=serS PE=3 SV=1 132 518 2.0E-31
sp|B2A2Z8|SYS_NATTJ Serine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=serS PE=3 SV=1 35 521 2.0E-31
sp|Q9JT77|SYS_NEIMA Serine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=serS PE=3 SV=1 142 525 3.0E-31
sp|A9FM88|SYS_SORC5 Serine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=serS PE=3 SV=1 96 519 3.0E-31
sp|B3EF00|SYS_CHLL2 Serine--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=serS PE=3 SV=1 35 518 3.0E-31
sp|Q72FH6|SYS_DESVH Serine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=serS PE=3 SV=1 231 525 3.0E-31
sp|A1VH35|SYS_DESVV Serine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=serS PE=3 SV=1 231 525 3.0E-31
sp|Q03MA3|SYS_STRTD Serine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=serS PE=3 SV=1 116 525 3.0E-31
sp|Q1MHM2|SYS_RHIL3 Serine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=serS PE=3 SV=1 129 525 3.0E-31
sp|A5IH84|SYS_LEGPC Serine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=serS PE=3 SV=1 84 525 3.0E-31
sp|Q87BX8|SYS_XYLFT Serine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=serS PE=3 SV=1 119 526 3.0E-31
sp|B2I631|SYS_XYLF2 Serine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=serS PE=3 SV=1 119 526 3.0E-31
sp|Q6AMD2|SYS_DESPS Serine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=serS PE=3 SV=1 35 521 4.0E-31
sp|Q6GD81|SYS_STAAS Serine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=serS PE=3 SV=1 119 528 4.0E-31
sp|A2C409|SYS_PROM1 Serine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=serS PE=3 SV=1 107 519 4.0E-31
sp|Q8UEQ2|SYS_AGRFC Serine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=serS PE=3 SV=2 121 525 4.0E-31
sp|Q4K9V7|SYS_PSEF5 Serine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=serS PE=3 SV=1 119 526 4.0E-31
sp|B2UX54|SYS_CLOBA Serine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=serS PE=3 SV=1 35 520 4.0E-31
sp|B2T1A6|SYS_BURPP Serine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=serS PE=3 SV=1 232 525 4.0E-31
sp|Q5X7N0|SYS_LEGPA Serine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=serS PE=3 SV=1 84 525 5.0E-31
sp|A8F3R6|SYS_PSELT Serine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=serS PE=3 SV=1 35 519 5.0E-31
sp|Q5WM19|SYS_BACSK Serine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=serS PE=3 SV=1 166 519 5.0E-31
sp|Q3ASQ9|SYS_CHLCH Serine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=serS PE=3 SV=1 35 518 6.0E-31
sp|A9M1Q6|SYS_NEIM0 Serine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=serS PE=3 SV=1 142 525 6.0E-31
sp|A1RRX4|SYS_PYRIL Serine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=serS PE=3 SV=1 118 523 6.0E-31
sp|A3PE37|SYS_PROM0 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=serS PE=3 SV=1 35 519 6.0E-31
sp|Q0BHH5|SYS_BURCM Serine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=serS PE=3 SV=1 232 528 6.0E-31
sp|C1DBY7|SYS_LARHH Serine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=serS PE=3 SV=1 119 525 6.0E-31
sp|Q82YY9|SYS2_ENTFA Serine--tRNA ligase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=serS2 PE=3 SV=1 143 525 6.0E-31
sp|Q8PLY2|SYS_XANAC Serine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=serS PE=3 SV=1 119 526 6.0E-31
sp|Q46JN0|SYS_PROMT Serine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=serS PE=3 SV=1 107 519 7.0E-31
sp|Q5WZ31|SYS_LEGPL Serine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=serS PE=3 SV=1 84 522 7.0E-31
sp|C3KXS1|SYS_CLOB6 Serine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=serS PE=3 SV=1 231 525 7.0E-31
sp|A8MEB3|SYS_ALKOO Serine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=serS PE=3 SV=1 116 525 8.0E-31
sp|B6ISM1|SYS_RHOCS Serine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=serS PE=3 SV=1 225 529 8.0E-31
sp|Q9JY95|SYS_NEIMB Serine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=serS PE=3 SV=1 142 525 8.0E-31
sp|Q8TIU3|SYS_METAC Serine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=serS PE=3 SV=1 35 525 8.0E-31
sp|A8FKH6|SYS_CAMJ8 Serine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=serS PE=3 SV=1 166 519 9.0E-31
sp|Q97N21|SYS2_CLOAB Serine--tRNA ligase 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=serS2 PE=3 SV=1 224 519 9.0E-31
sp|Q7VAZ8|SYS_PROMA Serine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=serS PE=3 SV=1 232 519 9.0E-31
sp|A8GPX3|SYS_RICAH Serine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=serS PE=3 SV=1 198 529 9.0E-31
sp|Q2SR32|SYS_MYCCT Serine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=serS PE=3 SV=1 222 525 1.0E-30
sp|Q5R9K9|SYSC_PONAB Serine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=SARS PE=2 SV=3 233 519 1.0E-30
sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=SARS PE=1 SV=3 233 519 1.0E-30
sp|B2THC5|SYS_CLOBB Serine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=serS PE=3 SV=1 35 520 1.0E-30
sp|B9JXD8|SYS_AGRVS Serine--tRNA ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=serS PE=3 SV=1 35 525 1.0E-30
sp|B4RN50|SYS_NEIG2 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=serS PE=3 SV=1 142 525 1.0E-30
sp|B0UUT7|SYS_HISS2 Serine--tRNA ligase OS=Histophilus somni (strain 2336) GN=serS PE=3 SV=1 143 526 1.0E-30
sp|Q0I471|SYS_HAES1 Serine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=serS PE=3 SV=1 143 526 1.0E-30
sp|Q899T6|SYS_CLOTE Serine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=serS PE=3 SV=1 226 521 1.0E-30
sp|Q7V0R7|SYS_PROMP Serine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=serS PE=3 SV=1 35 519 1.0E-30
sp|A0Q3T2|SYS_CLONN Serine--tRNA ligase OS=Clostridium novyi (strain NT) GN=serS PE=3 SV=1 232 525 1.0E-30
sp|Q6G036|SYS_BARQU Serine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=serS PE=3 SV=1 35 525 1.0E-30
sp|Q4UK35|SYS_RICFE Serine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=serS PE=3 SV=1 198 525 1.0E-30
sp|B4SF71|SYS_PELPB Serine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=serS PE=3 SV=1 35 518 1.0E-30
sp|Q1RKF4|SYS_RICBR Serine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=serS PE=3 SV=1 232 525 1.0E-30
sp|B5YGU2|SYS_THEYD Serine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=serS PE=3 SV=1 133 519 2.0E-30
sp|A4VLU7|SYS_PSEU5 Serine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=serS PE=3 SV=1 150 526 2.0E-30
sp|B0JTT9|SYS_MICAN Serine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=serS PE=3 SV=1 35 519 2.0E-30
sp|Q745I8|SYS_MYCPA Serine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=serS PE=3 SV=1 224 519 2.0E-30
sp|Q9I0M6|SYS_PSEAE Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=serS PE=3 SV=1 119 526 2.0E-30
sp|Q02NA4|SYS_PSEAB Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=serS PE=3 SV=1 119 526 2.0E-30
sp|B7UW10|SYS_PSEA8 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=serS PE=3 SV=1 119 526 2.0E-30
sp|A5N469|SYS_CLOK5 Serine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=serS PE=3 SV=1 35 521 2.0E-30
sp|B9DXT9|SYS_CLOK1 Serine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=serS PE=3 SV=1 35 521 2.0E-30
sp|Q0A7Z2|SYS_ALKEH Serine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=serS PE=3 SV=1 119 525 2.0E-30
sp|A5V3Y9|SYS_SPHWW Serine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=serS PE=3 SV=1 232 522 2.0E-30
sp|Q5FQ48|SYS_GLUOX Serine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=serS PE=3 SV=1 232 526 2.0E-30
sp|Q5ZY59|SYS_LEGPH Serine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=serS PE=3 SV=1 84 525 2.0E-30
sp|B1L1M0|SYS_CLOBM Serine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=serS PE=3 SV=1 231 525 2.0E-30
sp|B8G8S1|SYS_CHLAD Serine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=serS PE=3 SV=1 139 525 2.0E-30
sp|Q39IN7|SYS_BURL3 Serine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=serS PE=3 SV=1 232 528 3.0E-30
sp|A7G9C5|SYS_CLOBL Serine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=serS PE=3 SV=1 231 521 3.0E-30
sp|A5HXR1|SYS_CLOBH Serine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=serS PE=3 SV=1 35 525 3.0E-30
sp|A7FQ53|SYS_CLOB1 Serine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=serS PE=3 SV=1 35 525 3.0E-30
sp|B7KCF5|SYS_CYAP7 Serine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=serS PE=3 SV=1 144 519 3.0E-30
sp|C1FPI7|SYS_CLOBJ Serine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=serS PE=3 SV=1 231 521 3.0E-30
sp|A2SJA7|SYS_METPP Serine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=serS PE=3 SV=1 231 525 3.0E-30
sp|Q68VW6|SYS_RICTY Serine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=serS PE=3 SV=1 232 525 3.0E-30
sp|Q82KS8|SYS2_STRAW Serine--tRNA ligase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=serS2 PE=3 SV=1 140 530 3.0E-30
sp|Q5F752|SYS_NEIG1 Serine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=serS PE=3 SV=1 142 525 3.0E-30
sp|Q9ZCG5|SYS_RICPR Serine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=serS PE=3 SV=1 232 525 3.0E-30
sp|A0Q999|SYS_MYCA1 Serine--tRNA ligase OS=Mycobacterium avium (strain 104) GN=serS PE=3 SV=1 224 519 3.0E-30
sp|Q2YUR2|SYS_STAAB Serine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=serS PE=3 SV=1 145 528 3.0E-30
sp|B1IDV4|SYS_CLOBK Serine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=serS PE=3 SV=1 231 521 3.0E-30
sp|Q1H290|SYS_METFK Serine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=serS PE=3 SV=1 145 525 3.0E-30
sp|Q2SY90|SYS_BURTA Serine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=serS PE=3 SV=1 232 528 3.0E-30
sp|Q8EEQ9|SYS_SHEON Serine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=serS PE=3 SV=1 161 526 3.0E-30
sp|Q46F20|SYS_METBF Serine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=serS1 PE=1 SV=2 151 525 3.0E-30
sp|Q5Z3K9|SYS_NOCFA Serine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=serS PE=3 SV=1 225 519 4.0E-30
sp|Q07N47|SYS_RHOP5 Serine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=serS PE=3 SV=1 231 525 4.0E-30
sp|A8F2S3|SYS_RICM5 Serine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=serS PE=3 SV=1 198 525 4.0E-30
sp|A7GJT0|SYS_BACCN Serine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=serS PE=3 SV=1 231 521 4.0E-30
sp|A3NCC8|SYS_BURP6 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=serS PE=3 SV=1 232 528 4.0E-30
sp|A8GY58|SYS_RICB8 Serine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=serS PE=3 SV=1 232 525 4.0E-30
sp|B1YUL5|SYS_BURA4 Serine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=serS PE=3 SV=1 232 528 4.0E-30
sp|Q2NDM7|SYS_ERYLH Serine--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=serS PE=3 SV=1 130 525 4.0E-30
sp|Q0HV57|SYS_SHESR Serine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=serS PE=3 SV=1 161 526 5.0E-30
sp|Q0HIS7|SYS_SHESM Serine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=serS PE=3 SV=1 161 526 5.0E-30
sp|A0KWW5|SYS_SHESA Serine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=serS PE=3 SV=1 161 526 5.0E-30
sp|Q6MUG5|SYS_MYCMS Serine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=serS PE=3 SV=1 153 519 5.0E-30
sp|Q63RS1|SYS_BURPS Serine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|Q3JPQ8|SYS_BURP1 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|A3NY56|SYS_BURP0 Serine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|A1V1N6|SYS_BURMS Serine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|Q62HY1|SYS_BURMA Serine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|A2S9G4|SYS_BURM9 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|A3MMN2|SYS_BURM7 Serine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=serS PE=3 SV=1 232 528 5.0E-30
sp|B9KFN2|SYS_CAMLR Serine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=serS PE=3 SV=1 149 519 6.0E-30
sp|B3QV79|SYS_CHLT3 Serine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=serS PE=3 SV=1 231 526 6.0E-30
sp|B9IYI0|SYS_BACCQ Serine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=serS PE=3 SV=1 231 521 7.0E-30
sp|B7HPS8|SYS_BACC7 Serine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=serS PE=3 SV=1 231 521 7.0E-30
sp|Q4J8I4|SYS_SULAC Serine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=serS PE=3 SV=1 116 519 7.0E-30
sp|Q8EU77|SYS_OCEIH Serine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=serS PE=3 SV=1 35 526 7.0E-30
sp|Q8PA92|SYS_XANCP Serine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=serS PE=3 SV=1 165 526 8.0E-30
sp|B0RUV8|SYS_XANCB Serine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=serS PE=3 SV=1 165 526 8.0E-30
sp|Q4UTD4|SYS_XANC8 Serine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=serS PE=3 SV=1 165 526 8.0E-30
sp|Q0AJC4|SYS_NITEC Serine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=serS PE=3 SV=1 111 525 8.0E-30
sp|A9AY92|SYS_HERA2 Serine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=serS PE=3 SV=1 232 526 8.0E-30
sp|B1MEI9|SYS_MYCA9 Serine--tRNA ligase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=serS PE=3 SV=1 223 519 8.0E-30
sp|A0KJE8|SYS_AERHH Serine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=serS PE=3 SV=1 89 526 8.0E-30
sp|A5EXS3|SYS_DICNV Serine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=serS PE=3 SV=1 107 525 8.0E-30
sp|A6V4H5|SYS_PSEA7 Serine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=serS PE=3 SV=1 119 526 8.0E-30
sp|Q65SK3|SYS_MANSM Serine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=serS PE=3 SV=1 143 526 9.0E-30
sp|Q0I8C9|SYS_SYNS3 Serine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=serS PE=3 SV=1 225 519 9.0E-30
sp|B1XJM0|SYS_SYNP2 Serine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=serS PE=3 SV=1 225 519 9.0E-30
sp|A5GN16|SYS_SYNPW Serine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=serS PE=3 SV=1 149 519 9.0E-30
sp|A1K581|SYS_AZOSB Serine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=serS PE=3 SV=1 110 522 1.0E-29
sp|A5WFN9|SYS_PSYWF Serine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=serS PE=3 SV=1 141 525 1.0E-29
sp|Q67TJ8|SYS_SYMTH Serine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=serS PE=3 SV=1 35 518 1.0E-29
sp|Q9PB58|SYS_XYLFA Serine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=serS PE=3 SV=2 119 526 1.0E-29
sp|B9LIV1|SYS_CHLSY Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=serS PE=3 SV=1 139 526 1.0E-29
sp|A9WE34|SYS_CHLAA Serine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=serS PE=3 SV=1 139 526 1.0E-29
sp|B1Y9Y4|SYS_PYRNV Serine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=serS PE=3 SV=1 118 523 1.0E-29
sp|B4S6M3|SYS_PROA2 Serine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=serS PE=3 SV=1 35 518 1.0E-29
sp|C1DKY8|SYS_AZOVD Serine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=serS PE=3 SV=1 143 526 1.0E-29
sp|Q04XA4|SYS_LEPBL Serine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=serS PE=3 SV=1 225 519 1.0E-29
sp|Q04WE1|SYS_LEPBJ Serine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=serS PE=3 SV=1 225 519 1.0E-29
sp|Q7VG34|SYS_HELHP Serine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=serS PE=3 SV=1 133 519 1.0E-29
sp|A2C798|SYS_PROM3 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=serS PE=3 SV=1 93 519 2.0E-29
sp|Q2S1G4|SYS_SALRD Serine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=serS PE=3 SV=1 103 527 2.0E-29
sp|Q5LR07|SYS_RUEPO Serine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=serS PE=3 SV=1 93 521 2.0E-29
sp|B7IS31|SYS_BACC2 Serine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=serS PE=3 SV=1 231 521 2.0E-29
sp|Q63HF6|SYS_BACCZ Serine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=serS PE=3 SV=1 231 521 2.0E-29
sp|A0L6J8|SYS_MAGMM Serine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=serS PE=3 SV=1 232 526 2.0E-29
sp|A8G5Y6|SYS_PROM2 Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=serS PE=3 SV=1 224 519 2.0E-29
sp|Q2P3Y4|SYS_XANOM Serine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=serS PE=3 SV=1 119 526 2.0E-29
sp|Q81JC4|SYS_BACCR Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=serS PE=3 SV=1 231 521 2.0E-29
sp|B7HII5|SYS_BACC4 Serine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=serS PE=3 SV=1 231 521 2.0E-29
sp|A3D4J4|SYS_SHEB5 Serine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=serS PE=3 SV=1 161 526 2.0E-29
sp|A2BSA4|SYS_PROMS Serine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=serS PE=3 SV=1 225 519 2.0E-29
sp|C4K5T8|SYS_HAMD5 Serine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=serS PE=3 SV=1 145 525 2.0E-29
sp|Q3B5A4|SYS_CHLL7 Serine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=serS PE=3 SV=1 35 518 3.0E-29
sp|Q6HPZ8|SYS_BACHK Serine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|C1ES19|SYS_BACC3 Serine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|B7JJC8|SYS_BACC0 Serine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|Q81W25|SYS_BACAN Serine--tRNA ligase OS=Bacillus anthracis GN=serS PE=3 SV=1 231 521 3.0E-29
sp|A0R891|SYS_BACAH Serine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|C3LIY9|SYS_BACAC Serine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|C3P9G2|SYS_BACAA Serine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=serS PE=3 SV=1 231 521 3.0E-29
sp|Q2IWG6|SYS_RHOP2 Serine--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=serS PE=3 SV=1 231 525 3.0E-29
sp|Q1QME2|SYS_NITHX Serine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=serS PE=3 SV=1 231 525 3.0E-29
sp|Q143D9|SYS_BURXL Serine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=serS PE=3 SV=1 232 528 3.0E-29
sp|Q0VQ06|SYS_ALCBS Serine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=serS PE=3 SV=1 231 525 3.0E-29
sp|A1S6H5|SYS_SHEAM Serine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=serS PE=3 SV=1 119 526 3.0E-29
sp|A9L269|SYS_SHEB9 Serine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=serS PE=3 SV=1 152 526 4.0E-29
sp|A6WNG1|SYS_SHEB8 Serine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=serS PE=3 SV=1 152 526 4.0E-29
sp|Q2GKS1|SYS_ANAPZ Serine--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=serS PE=3 SV=1 234 519 4.0E-29
sp|Q8DIN0|SYS_THEEB Serine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=serS PE=3 SV=1 230 527 4.0E-29
sp|A4G3W7|SYS_HERAR Serine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=serS PE=3 SV=1 149 525 4.0E-29
sp|B8FNA6|SYS_DESAA Serine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=serS PE=3 SV=1 231 521 4.0E-29
sp|B8ZLH8|SYS_STRPJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=serS PE=3 SV=1 145 525 4.0E-29
sp|Q88FT2|SYS_PSEPK Serine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=serS PE=3 SV=1 88 525 4.0E-29
sp|C1CIR2|SYS_STRZP Serine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=serS PE=3 SV=1 145 525 4.0E-29
sp|C1C5E8|SYS_STRP7 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=serS PE=3 SV=1 145 525 4.0E-29
sp|Q8EY78|SYS_LEPIN Serine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=serS PE=3 SV=1 225 519 4.0E-29
sp|Q72LS1|SYS_LEPIC Serine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=serS PE=3 SV=1 225 519 4.0E-29
sp|Q8PYJ6|SYS_METMA Serine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=serS PE=3 SV=1 151 525 4.0E-29
sp|A1WWU7|SYS_HALHL Serine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=serS PE=3 SV=1 124 526 5.0E-29
sp|Q7U518|SYS_SYNPX Serine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=serS PE=3 SV=1 149 519 5.0E-29
sp|C5D340|SYS_GEOSW Serine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=serS PE=3 SV=1 231 525 5.0E-29
sp|A4Y6Z5|SYS_SHEPC Serine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=serS PE=3 SV=1 161 526 5.0E-29
sp|C0R1U9|SYS_BRAHW Serine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=serS PE=3 SV=1 35 529 6.0E-29
sp|A3CQ45|SYS_STRSV Serine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=serS PE=3 SV=1 116 526 6.0E-29
sp|Q5SJX7|SYS_THET8 Serine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=serS PE=3 SV=1 114 519 6.0E-29
sp|A4XUX4|SYS_PSEMY Serine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=serS PE=3 SV=1 143 526 7.0E-29
sp|A1RJJ4|SYS_SHESW Serine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=serS PE=3 SV=1 161 526 7.0E-29
sp|C6BS43|SYS_DESAD Serine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=serS PE=3 SV=1 228 525 7.0E-29
sp|Q9A6T4|SYS_CAUCR Serine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=serS PE=3 SV=1 96 527 7.0E-29
sp|B8GX53|SYS_CAUCN Serine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=serS PE=3 SV=1 96 527 7.0E-29
sp|Q970Y4|SYS_SULTO Serine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=serS PE=3 SV=1 139 524 8.0E-29
sp|Q7V608|SYS_PROMM Serine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=serS PE=3 SV=2 93 519 8.0E-29
sp|A8EZY3|SYS_RICCK Serine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=serS PE=3 SV=1 232 525 8.0E-29
sp|B8EET7|SYS_SHEB2 Serine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=serS PE=3 SV=1 161 526 9.0E-29
sp|Q8DR22|SYS_STRR6 Serine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=serS PE=3 SV=2 145 525 9.0E-29
sp|Q04M63|SYS_STRP2 Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=serS PE=3 SV=1 145 525 9.0E-29
sp|Q9CDC1|SYS_MYCLE Serine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=serS PE=3 SV=1 231 519 1.0E-28
sp|B8ZTU5|SYS_MYCLB Serine--tRNA ligase OS=Mycobacterium leprae (strain Br4923) GN=serS PE=3 SV=1 231 519 1.0E-28
sp|B0T1Q3|SYS_CAUSK Serine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=serS PE=3 SV=1 143 527 1.0E-28
sp|P67566|SYS_STRA5 Serine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=serS PE=3 SV=1 116 525 1.0E-28
sp|P67565|SYS_STRA3 Serine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=serS PE=3 SV=1 116 525 1.0E-28
sp|Q3K326|SYS_STRA1 Serine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=serS PE=3 SV=1 116 525 1.0E-28
sp|A5UFR9|SYS_HAEIG Serine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=serS PE=3 SV=1 119 526 1.0E-28
sp|C1CCH7|SYS_STRZJ Serine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=serS PE=3 SV=1 145 525 1.0E-28
sp|Q73FJ3|SYS_BACC1 Serine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=serS PE=3 SV=1 231 521 1.0E-28
sp|Q926Z9|SYS_LISIN Serine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=serS PE=3 SV=1 231 528 1.0E-28
sp|Q0C0W2|SYS_HYPNA Serine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=serS PE=3 SV=1 35 525 1.0E-28
sp|B0KLW8|SYS_PSEPG Serine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=serS PE=3 SV=1 88 525 1.0E-28
sp|C1CPS1|SYS_STRZT Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=serS PE=3 SV=1 145 525 1.0E-28
sp|Q97SG0|SYS_STRPN Serine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=serS PE=3 SV=1 145 525 1.0E-28
sp|A8FAD7|SYS_BACP2 Serine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=serS PE=3 SV=1 144 519 1.0E-28
sp|Q3YS14|SYS_EHRCJ Serine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=serS PE=3 SV=1 232 525 1.0E-28
sp|A4SNK6|SYS_AERS4 Serine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=serS PE=3 SV=1 119 526 1.0E-28
sp|B1I9K5|SYS_STRPI Serine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=serS PE=3 SV=1 145 525 1.0E-28
sp|Q4QP70|SYS_HAEI8 Serine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=serS PE=3 SV=1 119 526 1.0E-28
sp|Q6LT00|SYS_PHOPR Serine--tRNA ligase OS=Photobacterium profundum GN=serS PE=3 SV=1 95 526 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0000166 nucleotide binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0005488 binding No
GO:0006082 organic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043038 amino acid activation No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0043039 tRNA aminoacylation No
GO:0043436 oxoacid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0006399 tRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0016874 ligase activity No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0030554 adenyl nucleotide binding No
GO:0006520 cellular amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 408 430 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7246
MNRSPARLRLRGIEPRAWRRSFGEDRRPSSAPKPMLDMKHIRQNAHLYEQTCVDRKYDRLAGHASRIVALHGQWL
DLQREGRSMRERSKYLRKMLARQAASDDGTNSSSSSSSSSIRDEDQQQQQQPPSAESQTSTTTREQALDEARRLK
ADLARIEKGEAAAVAEMEMLALELPNLTSDDAPRGNEPTLLRYINSPPAGFDEPCSSSTTTTCSSSSSSFPSPHP
TDEKPPRTHVEIGTELGILDLAAGATSSGWGWYYLIGAGAQLEQALIQYALGLASQRRFTPVSPPSLVYSHVGAA
CGFRPRDHHGEQQVYSVDGTPDRCLAGTSEIALAAMAAQATLPFDVLPLRRVAVSRCYRAEAGARGADTKGLFRV
HEFTKVELFAWSAPETETARRLLDEMVALQVDILASLGLYSVVVVVVVVIIIIIVDDDDDDDDNDQAANDGWGEL
TSASLCTDYQTRRLATRVRLPSESNRLAFPYTINATALAVPRVLAALLEYGWDEASRTVVVPRCLRPWMHGMRRI
GGPGGRPLG
Coding >Ophio5|7246
ATGAATCGCAGCCCGGCAAGGCTGCGCCTCCGCGGCATTGAGCCCCGAGCATGGCGGCGCAGCTTCGGCGAAGAC
CGAAGACCGAGCTCGGCGCCGAAGCCGATGCTGGACATGAAGCACATCCGACAGAACGCCCATCTGTACGAGCAG
ACGTGCGTCGATCGCAAGTACGACCGGCTGGCGGGCCACGCCAGCCGCATCGTCGCCCTGCACGGCCAGTGGCTA
GACCTGCAGCGCGAGGGACGGTCGATGCGAGAACGGTCCAAGTATCTGCGAAAGATGCTGGCCAGACAGGCGGCG
AGCGATGATGGAACGAATAGCAGCAGCAGCAGCAGCAGCAGCAGTATCCGAGACGAAGACCAGCAGCAGCAGCAG
CAGCCGCCTAGCGCCGAGAGCCAGACGTCGACGACGACGCGAGAGCAGGCGCTCGATGAGGCTCGTCGCCTCAAG
GCTGACCTCGCTCGTATCGAAAAGGGCGAGGCGGCGGCGGTGGCGGAAATGGAGATGCTGGCTCTCGAGCTGCCT
AACCTGACGAGTGATGATGCGCCGCGCGGGAACGAGCCTACGCTGCTACGCTACATCAACAGTCCACCAGCAGGC
TTCGACGAGCCTTGTTCTTCTTCTACTACTACTACTTGTTCTTCTTCTTCTTCTTCTTTTCCTTCTCCTCATCCT
ACAGACGAGAAGCCACCACGGACACACGTCGAAATCGGCACCGAGCTAGGCATCCTCGACCTCGCCGCCGGGGCC
ACATCCTCCGGCTGGGGCTGGTACTACCTCATCGGGGCAGGCGCCCAACTGGAACAAGCGCTGATCCAGTACGCG
TTGGGGCTGGCCTCGCAGCGCCGCTTCACTCCCGTCTCGCCTCCGAGCCTGGTCTACAGCCACGTCGGGGCCGCC
TGCGGCTTCCGTCCTCGCGACCATCACGGCGAGCAGCAGGTCTACTCGGTCGACGGCACGCCCGACCGCTGCCTG
GCCGGCACGTCGGAGATTGCCCTCGCCGCTATGGCGGCCCAGGCTACCCTCCCCTTTGACGTCTTGCCCTTGAGG
CGCGTCGCCGTCTCGCGCTGTTATCGTGCTGAGGCCGGTGCTCGCGGCGCTGATACCAAGGGCTTGTTCCGCGTT
CATGAATTCACAAAGGTCGAGCTCTTTGCTTGGTCCGCCCCGGAGACGGAGACGGCTAGGCGCCTGCTCGATGAA
ATGGTCGCTCTACAAGTCGACATTCTCGCCTCCTTGGGCCTCTACTCCGTCGTCGTCGTCGTCGTCGTCGTCATC
ATCATCATCATCGTCGACGACGACGACGACGACGACGACAACGACCAAGCCGCCAACGACGGCTGGGGCGAGCTC
ACGTCCGCCAGCCTCTGCACCGACTACCAAACCCGCCGGCTAGCGACGCGCGTCCGCCTCCCGTCCGAGAGCAAC
CGGCTGGCCTTCCCGTACACCATCAACGCCACCGCCCTCGCTGTCCCGCGCGTCCTCGCTGCGCTGCTCGAGTAC
GGCTGGGATGAGGCGTCGCGCACCGTCGTCGTGCCTCGGTGTTTGCGACCTTGGATGCATGGAATGCGTCGCATT
GGTGGCCCGGGAGGGCGGCCGCTAGGT
Transcript >Ophio5|7246
ATGAATCGCAGCCCGGCAAGGCTGCGCCTCCGCGGCATTGAGCCCCGAGCATGGCGGCGCAGCTTCGGCGAAGAC
CGAAGACCGAGCTCGGCGCCGAAGCCGATGCTGGACATGAAGCACATCCGACAGAACGCCCATCTGTACGAGCAG
ACGTGCGTCGATCGCAAGTACGACCGGCTGGCGGGCCACGCCAGCCGCATCGTCGCCCTGCACGGCCAGTGGCTA
GACCTGCAGCGCGAGGGACGGTCGATGCGAGAACGGTCCAAGTATCTGCGAAAGATGCTGGCCAGACAGGCGGCG
AGCGATGATGGAACGAATAGCAGCAGCAGCAGCAGCAGCAGCAGTATCCGAGACGAAGACCAGCAGCAGCAGCAG
CAGCCGCCTAGCGCCGAGAGCCAGACGTCGACGACGACGCGAGAGCAGGCGCTCGATGAGGCTCGTCGCCTCAAG
GCTGACCTCGCTCGTATCGAAAAGGGCGAGGCGGCGGCGGTGGCGGAAATGGAGATGCTGGCTCTCGAGCTGCCT
AACCTGACGAGTGATGATGCGCCGCGCGGGAACGAGCCTACGCTGCTACGCTACATCAACAGTCCACCAGCAGGC
TTCGACGAGCCTTGTTCTTCTTCTACTACTACTACTTGTTCTTCTTCTTCTTCTTCTTTTCCTTCTCCTCATCCT
ACAGACGAGAAGCCACCACGGACACACGTCGAAATCGGCACCGAGCTAGGCATCCTCGACCTCGCCGCCGGGGCC
ACATCCTCCGGCTGGGGCTGGTACTACCTCATCGGGGCAGGCGCCCAACTGGAACAAGCGCTGATCCAGTACGCG
TTGGGGCTGGCCTCGCAGCGCCGCTTCACTCCCGTCTCGCCTCCGAGCCTGGTCTACAGCCACGTCGGGGCCGCC
TGCGGCTTCCGTCCTCGCGACCATCACGGCGAGCAGCAGGTCTACTCGGTCGACGGCACGCCCGACCGCTGCCTG
GCCGGCACGTCGGAGATTGCCCTCGCCGCTATGGCGGCCCAGGCTACCCTCCCCTTTGACGTCTTGCCCTTGAGG
CGCGTCGCCGTCTCGCGCTGTTATCGTGCTGAGGCCGGTGCTCGCGGCGCTGATACCAAGGGCTTGTTCCGCGTT
CATGAATTCACAAAGGTCGAGCTCTTTGCTTGGTCCGCCCCGGAGACGGAGACGGCTAGGCGCCTGCTCGATGAA
ATGGTCGCTCTACAAGTCGACATTCTCGCCTCCTTGGGCCTCTACTCCGTCGTCGTCGTCGTCGTCGTCGTCATC
ATCATCATCATCGTCGACGACGACGACGACGACGACGACAACGACCAAGCCGCCAACGACGGCTGGGGCGAGCTC
ACGTCCGCCAGCCTCTGCACCGACTACCAAACCCGCCGGCTAGCGACGCGCGTCCGCCTCCCGTCCGAGAGCAAC
CGGCTGGCCTTCCCGTACACCATCAACGCCACCGCCCTCGCTGTCCCGCGCGTCCTCGCTGCGCTGCTCGAGTAC
GGCTGGGATGAGGCGTCGCGCACCGTCGTCGTGCCTCGGTGTTTGCGACCTTGGATGCATGGAATGCGTCGCATT
GGTGGCCCGGGAGGGCGGCCGCTAGGTTAA
Gene >Ophio5|7246
ATGAATCGCAGCCCGGCAAGGCTGCGCCTCCGCGGCATTGAGCCCCGAGCATGGCGGCGCAGCTTCGGCGAAGAC
CGAAGACCGAGCTCGGCGCCGAAGCCGATGCTGGACATGAAGCACATCCGACAGAACGCCCATCTGTACGAGCAG
ACGTGCGTCGATCGCAAGTACGACCGGCTGGCGGGCCACGCCAGCCGCATCGTCGCCCTGCACGGCCAGTGGCTA
GACCTGCAGCGCGAGGGACGGTCGATGCGAGAACGGTCCAAGTATCTGCGAAAGATGCTGGCCAGACAGGCGGCG
AGCGATGATGGAACGAATAGCAGCAGCAGCAGCAGCAGCAGCAGTATCCGAGACGAAGACCAGCAGCAGCAGCAG
CAGCCGCCTAGCGCCGAGAGCCAGACGTCGACGACGACGCGAGAGCAGGCGCTCGATGAGGCTCGTCGCCTCAAG
GCTGACCTCGCTCGTATCGAAAAGGGCGAGGCGGCGGCGGTGGCGGAAATGGAGATGCTGGCTCTCGAGCTGCCT
AACCTGACGAGTGATGATGCGCCGCGCGGGAACGAGCCTACGCTGCTACGCTACATCAACAGTCCACCAGCAGGC
TTCGACGAGCCTTGTTCTTCTTCTACTACTACTACTTGTTCTTCTTCTTCTTCTTCTTTTCCTTCTCCTCATCCT
ACAGACGAGAAGCCACCACGGACACACGTCGAAATCGGCACCGAGCTAGGCATCCTCGACCTCGCCGCCGGGGCC
ACATCCTCCGGCTGGGGCTGGTACTACCTCATCGGGGCAGGCGCCCAACTGGAACAAGCGCTGATCCAGTACGCG
TTGGGGCTGGCCTCGCAGCGCCGCTTCACTCCCGTCTCGCCTCCGAGCCTGGTCTACAGCCACGTCGGGGCCGCC
TGCGGCTTCCGTCCTCGCGACCATCACGGCGAGCAGCAGGTCTACTCGGTCGACGGCACGCCCGACCGCTGCCTG
GCCGGCACGTCGGAGATTGCCCTCGCCGCTATGGCGGCCCAGGCTACCCTCCCCTTTGACGTCTTGCCCTTGAGG
CGCGTCGCCGTCTCGCGCTGTTATCGTGCTGAGGCCGGTGCTCGCGGCGCTGATACCAAGGGCTTGTTCCGCGTT
CATGAATTCACAAAGGTCGAGCTCTTTGCTTGGTCCGCCCCGGAGACGGAGACGGCTAGGCGCCTGCTCGATGAA
ATGGTCGCTCTACAAGTCGACATTCTCGCCTCCTTGGGCCTCTACTGTCGCGTCCTGGCCATGCCCGTCTCCGAC
CTCGGCGCCTCGGCTTCTTTCAAAATCGACATCGAAGCCTACTTTCCCAGCCGTCGTCGTCGTCGTCGTCGTCGT
CATCATCATCATCATCGTCGACGACGACGACGACGACGACGACAACGACCAAGCCGCCAACGACGGCTGGGGCGA
GCTCACGTCCGCCAGCCTCTGCACCGACTACCAAACCCGCCGGCTAGCGACGCGCGTCCGCCTCCCGTCCGAGAG
CAACCGGCTGGCCTTCCCGTACACCATCAACGCCACCGCCCTCGCTGTCCCGCGCGTCCTCGCTGCGCTGCTCGA
GTACGGCTGGGATGAGGCGTCGCGCACCGTCGTCGTGCCTCGGTGTTTGCGACCTTGGATGCATGGAATGCGTCG
CATTGGTGGCCCGGGAGGGCGGCCGCTAGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail