Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7235
Gene name
Locationscaffold_686:1816..3580
Strand+
Gene length (bp)1764
Transcript length (bp)1644
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-40 76 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 36 509 2.0E-97
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 54 509 2.0E-92
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 8 505 9.0E-90
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 25 503 6.0E-89
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 55 507 1.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 36 509 2.0E-97
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 54 509 2.0E-92
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 8 505 9.0E-90
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 25 503 6.0E-89
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 55 507 1.0E-88
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 44 513 2.0E-87
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 5 507 6.0E-87
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 14 507 3.0E-85
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 11 509 3.0E-84
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 36 509 4.0E-84
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 510 2.0E-80
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 44 506 6.0E-79
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 55 509 4.0E-77
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 45 484 1.0E-71
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 55 508 8.0E-71
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 74 510 2.0E-70
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 542 2.0E-70
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 55 508 6.0E-70
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 45 509 2.0E-66
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 55 507 9.0E-65
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 56 501 3.0E-64
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 56 501 2.0E-63
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 55 507 9.0E-63
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 55 507 1.0E-62
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 56 503 9.0E-59
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 37 501 7.0E-43
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 54 520 5.0E-40
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 89 509 1.0E-32
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 56 267 1.0E-26
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 44 248 3.0E-23
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 360 501 5.0E-21
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 96 475 1.0E-19
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 54 537 1.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 301 497 2.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 241 471 2.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 35 470 4.0E-09
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 96 249 5.0E-09
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 70 247 2.0E-08
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 96 226 8.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 96 226 3.0E-06
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 52 249 5.0E-06
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 2 248 8.0E-06
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 68 224 8.0E-06
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 124 226 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 106 128 22
3 137 156 19
4 161 183 22
5 195 217 22
6 232 254 22
7 305 327 22
8 337 359 22
9 379 398 19
10 408 430 22
11 437 459 22
12 474 496 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7235
MDGYGDIEALRRPAARTSHFALLLDPAGADDAAIARKYPGHGTPESPFIVDFLPNDARNPVTFAASFKWLITWLA
AFSTLAVSFASSAYSGGISYIRADFAVSSEVVILGVSMFVLGFAIGPLIWAPLSELYGRQRIYFVTYMALTAFNA
AAAGAPSMTALVVLRFFAGAFGSSPLTNSGGVIADMFSAEERGLATSIFALAPFLGPALGPIASGFLGEAAGWRW
VEGLMAIFSGTIWILYSCICPETYVPFLLRQRAAALSRKTGHAYVSKLDAGKPKTSVAAQFRVALSRPWLLLFRE
PIVLLTALYMAIIYGTLYMCFAAFPIVFQQGRGWKPGTGGLAFCGIAAGMSIALIGNLFDDRRFQRVVIRSQGAP
PPEARLPPALVGCVLIPIGLFWFAWTNGPTFHWALPIIGSAFFAAGIVLVFLSLMNYIIDSYVIFAASALAANSV
LRSLFGAIFPLFTTYMYKGLGTNWASSVPAFLALVCVPFPFLFYRYGAGIRMRCKYAAEAAHMLDLVRAKQTQMT
EDEATTEADEAEKTTRHGGRTS
Coding >Ophio5|7235
ATGGACGGCTACGGTGATATCGAGGCCCTGCGTCGGCCGGCCGCCAGGACCTCTCACTTCGCCCTTCTCCTCGAC
CCAGCCGGCGCCGACGACGCCGCCATCGCTCGCAAATATCCCGGCCATGGCACGCCTGAGTCGCCTTTTATCGTC
GACTTTCTGCCCAATGATGCCCGCAACCCCGTCACATTCGCCGCTTCCTTCAAATGGCTCATCACCTGGCTTGCC
GCCTTCTCCACGCTGGCCGTCTCGTTCGCCAGCTCTGCCTACTCGGGAGGCATCAGTTACATCAGGGCCGACTTC
GCCGTCTCTTCCGAGGTTGTTATCCTCGGCGTCTCCATGTTCGTCTTGGGCTTCGCCATCGGGCCCCTCATCTGG
GCGCCCTTGTCGGAACTCTATGGCCGCCAGCGCATCTACTTCGTCACCTACATGGCCCTGACTGCTTTCAACGCC
GCTGCTGCCGGGGCCCCGTCCATGACTGCCCTGGTCGTTCTCCGCTTCTTTGCCGGCGCCTTCGGTTCCTCCCCC
TTGACCAACTCTGGCGGTGTCATCGCCGACATGTTCTCCGCCGAGGAGCGCGGCCTCGCTACTAGTATTTTCGCT
TTGGCCCCTTTCCTCGGCCCTGCCCTCGGCCCCATTGCTAGTGGCTTTCTCGGCGAGGCCGCGGGCTGGCGCTGG
GTGGAGGGTTTGATGGCCATTTTTTCCGGCACCATATGGATCCTCTACTCTTGCATCTGTCCCGAGACGTATGTG
CCTTTCTTGCTCCGCCAGCGCGCCGCCGCCCTGTCGCGCAAGACGGGCCACGCCTACGTGAGCAAGCTAGACGCC
GGGAAGCCCAAGACCAGCGTCGCTGCTCAGTTCAGAGTCGCCCTCTCCCGACCTTGGCTTCTCCTCTTCCGAGAG
CCCATTGTTCTGCTGACGGCGCTGTACATGGCCATCATATACGGCACGCTGTACATGTGCTTTGCTGCCTTCCCC
ATCGTCTTCCAGCAGGGCAGGGGATGGAAGCCCGGCACCGGCGGCCTGGCCTTCTGCGGAATCGCTGCCGGCATG
TCCATTGCTCTGATCGGCAACCTCTTTGATGACAGGCGCTTTCAGAGGGTCGTGATCCGCTCACAGGGCGCTCCG
CCGCCCGAGGCTCGACTGCCCCCGGCGCTGGTTGGATGTGTTCTCATCCCGATAGGGCTCTTTTGGTTCGCCTGG
ACCAACGGCCCCACGTTCCACTGGGCGCTGCCCATCATCGGCTCGGCCTTCTTCGCTGCCGGCATTGTCCTGGTC
TTCTTGTCCCTGATGAACTACATCATTGATTCGTATGTCATCTTTGCCGCGTCGGCACTCGCTGCCAACTCGGTC
CTGCGATCGCTGTTCGGGGCCATCTTTCCCCTTTTCACGACGTACATGTACAAAGGCCTCGGCACCAACTGGGCA
AGCTCGGTCCCGGCGTTCCTGGCGCTCGTCTGTGTGCCGTTTCCCTTCCTCTTTTACCGGTACGGCGCTGGAATC
CGCATGAGGTGCAAGTACGCGGCCGAGGCTGCCCACATGCTCGACCTGGTACGGGCCAAGCAGACGCAGATGACG
GAGGACGAGGCGACTACGGAGGCGGACGAAGCCGAGAAGACGACGCGGCACGGCGGCAGGACGTCG
Transcript >Ophio5|7235
ATGGACGGCTACGGTGATATCGAGGCCCTGCGTCGGCCGGCCGCCAGGACCTCTCACTTCGCCCTTCTCCTCGAC
CCAGCCGGCGCCGACGACGCCGCCATCGCTCGCAAATATCCCGGCCATGGCACGCCTGAGTCGCCTTTTATCGTC
GACTTTCTGCCCAATGATGCCCGCAACCCCGTCACATTCGCCGCTTCCTTCAAATGGCTCATCACCTGGCTTGCC
GCCTTCTCCACGCTGGCCGTCTCGTTCGCCAGCTCTGCCTACTCGGGAGGCATCAGTTACATCAGGGCCGACTTC
GCCGTCTCTTCCGAGGTTGTTATCCTCGGCGTCTCCATGTTCGTCTTGGGCTTCGCCATCGGGCCCCTCATCTGG
GCGCCCTTGTCGGAACTCTATGGCCGCCAGCGCATCTACTTCGTCACCTACATGGCCCTGACTGCTTTCAACGCC
GCTGCTGCCGGGGCCCCGTCCATGACTGCCCTGGTCGTTCTCCGCTTCTTTGCCGGCGCCTTCGGTTCCTCCCCC
TTGACCAACTCTGGCGGTGTCATCGCCGACATGTTCTCCGCCGAGGAGCGCGGCCTCGCTACTAGTATTTTCGCT
TTGGCCCCTTTCCTCGGCCCTGCCCTCGGCCCCATTGCTAGTGGCTTTCTCGGCGAGGCCGCGGGCTGGCGCTGG
GTGGAGGGTTTGATGGCCATTTTTTCCGGCACCATATGGATCCTCTACTCTTGCATCTGTCCCGAGACGTATGTG
CCTTTCTTGCTCCGCCAGCGCGCCGCCGCCCTGTCGCGCAAGACGGGCCACGCCTACGTGAGCAAGCTAGACGCC
GGGAAGCCCAAGACCAGCGTCGCTGCTCAGTTCAGAGTCGCCCTCTCCCGACCTTGGCTTCTCCTCTTCCGAGAG
CCCATTGTTCTGCTGACGGCGCTGTACATGGCCATCATATACGGCACGCTGTACATGTGCTTTGCTGCCTTCCCC
ATCGTCTTCCAGCAGGGCAGGGGATGGAAGCCCGGCACCGGCGGCCTGGCCTTCTGCGGAATCGCTGCCGGCATG
TCCATTGCTCTGATCGGCAACCTCTTTGATGACAGGCGCTTTCAGAGGGTCGTGATCCGCTCACAGGGCGCTCCG
CCGCCCGAGGCTCGACTGCCCCCGGCGCTGGTTGGATGTGTTCTCATCCCGATAGGGCTCTTTTGGTTCGCCTGG
ACCAACGGCCCCACGTTCCACTGGGCGCTGCCCATCATCGGCTCGGCCTTCTTCGCTGCCGGCATTGTCCTGGTC
TTCTTGTCCCTGATGAACTACATCATTGATTCGTATGTCATCTTTGCCGCGTCGGCACTCGCTGCCAACTCGGTC
CTGCGATCGCTGTTCGGGGCCATCTTTCCCCTTTTCACGACGTACATGTACAAAGGCCTCGGCACCAACTGGGCA
AGCTCGGTCCCGGCGTTCCTGGCGCTCGTCTGTGTGCCGTTTCCCTTCCTCTTTTACCGGTACGGCGCTGGAATC
CGCATGAGGTGCAAGTACGCGGCCGAGGCTGCCCACATGCTCGACCTGGTACGGGCCAAGCAGACGCAGATGACG
GAGGACGAGGCGACTACGGAGGCGGACGAAGCCGAGAAGACGACGCGGCACGGCGGCAGGACGTCGTGA
Gene >Ophio5|7235
ATGGACGGCTACGGTGATATCGAGGCCCTGCGTCGGCCGGCCGCCAGGACCTCTCACTTCGCCCTTCTCCTCGAC
CCAGCCGGCGCCGACGACGCCGCCATCGCTCGCAAATATCCCGGCCATGGCACGCCTGAGTCGCCTTTTATCGTC
GACTTTCTGCCCAATGATGCCCGCAACCCCGTCACATTCGCCGCTTCCTTCAAATGGCTCATCACCTGGCTTGCC
GCCTTCTCCACGCTGGCCGTCTCGTTCGCCAGCTCTGCCTACTCGGGAGGCATCAGTTACATCAGGGCCGACTTC
GCCGTCTCTTCCGAGGTTGTTATCCTCGGCGTCTCCATGTTCGTCTTGGGCTTCGCCATCGGGCCCCTCATCTGG
GCGCCCTTGTCGGAACTCTATGGCCGCCAGCGCATCTACTTCGTCACCTACATGGCCCTGACTGCTTTCAACGCC
GCTGCTGCCGGGGCCCCGTCCATGACTGCCCTGGTCGTTCTCCGCTTCTTTGCCGGCGCCTTCGGTTCCTCCCCC
TTGACCAACTCTGGCGGTGTCATCGCCGACATGTTCTCCGCCGAGGAGCGCGGCCTCGCTACTAGTATTTTCGCT
TTGGCCCCTTTCCTCGGCCCTGCCCTCGGTAAGGAACCAGCCACTCCTGACCCCTGGCTTCGCTTGCCCGTCGCT
GATGCTGTTGTATAGGCCCCATTGCTAGTGGCTTTCTCGGCGAGGCCGCGGGCTGGCGCTGGGTGGAGGGTTTGA
TGGCCATTTTTTCCGGCACCATATGGATCCTCTACTCTTGCATCTGTCCCGAGACGTATGTGCCTTTCTTGCTCC
GCCAGCGCGCCGCCGCCCTGTCGCGCAAGACGGGCCACGCCTACGTGAGCAAGCTAGACGCCGGGAAGCCCAAGA
CCAGCGTCGCTGCTCAGTTCAGAGTCGCCCTCTCCCGACCTTGGCTTCTCCTCTTCCGAGAGCCCATTGTTCTGC
TGACGGCGCTGTACATGGCCATCATATACGGCACGCTGTACATGTGCTTTGCTGCCTTCCCCATCGTCTTCCAGC
AGGGCAGGGGATGGAAGCCCGGCACCGGCGGCCTGGCCTTCTGCGGAATCGCTGCCGGCATGTCCATTGCTCTGA
TCGGCAACCTCTTTGATGACAGGCGCTTTCAGAGGGTCGTGATCCGCTCACAGGGCGCTCCGCCGCCCGAGGCTC
GACTGCCCCCGGCGCTGGTTGGATGTGTTCTCATCCCGATAGGGCTCTTTTGGTTCGCCTGGACCAACGGCCCCA
CGTTCCACTGGGCGCTGCCCATCATCGGCTCGGCCTTCTTCGCTGCCGGCATTGTCCTGGTCTTCTTGTCCCTGA
TGAACTACATCATTGATTCGTGTAGGTTTGCTGGGACGCGCGATTGTGGAGGTGAGGGCGCTGACAGACCGGGGT
CCAGATGTCATCTTTGCCGCGTCGGCACTCGCTGCCAACTCGGTCCTGCGATCGCTGTTCGGGGCCATCTTTCCC
CTTTTCACGACGTACATGTACAAAGGCCTCGGCACCAACTGGGCAAGCTCGGTCCCGGCGTTCCTGGCGCTCGTC
TGTGTGCCGTTTCCCTTCCTCTTTTACCGGTACGGCGCTGGAATCCGCATGAGGTGCAAGTACGCGGCCGAGGCT
GCCCACATGCTCGACCTGGTACGGGCCAAGCAGACGCAGATGACGGAGGACGAGGCGACTACGGAGGCGGACGAA
GCCGAGAAGACGACGCGGCACGGCGGCAGGACGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail