Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7229
Gene name
Locationscaffold_684:2688..4918
Strand-
Gene length (bp)2230
Transcript length (bp)2121
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00582 Usp Universal stress protein family 3.7E-23 471 671

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 575 694 7.0E-30
sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 397 508 9.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7229
MAGDPSRPMSIDAMLDMERQEVLALLENKNQGPSSPERIRPSSPYTSAPPRSPVRSLLDIEEEGPSGTRTAPTTQ
GPVRSMLDVDTPAAATQPPVRSMLDIDAPSPPPSATFRSSSPASPGLAAHPKSPMSQGYFPRSMSGPGLRPADRG
DRTSQYQFSGILSHNSGQPRRAPQHSKRLSTGSLGEAMRSPDLSGLQLPGERGRNPSIGSRLGNQSKSPHERWEA
RSRSPMFSPAMSPSKAMLGDGQTFDINSAYRRLSDANLAVSSGSLAQLPLRKRTEELGEGRLIKDYLGPDGEHLE
SSDDDEPHSSDDEDRGRKTAPRTLNSDARGDSEHSKSRSPSGREERQSLSLLAAAEQERLQLAAQPPTYQYRSLI
PEPEIKITNSAGDTLKSPKPGIHPHTSYDQEPLSATPSGIDSDDEAEDDIKRAQKLAFSMTSILTSPEQHRAIRI
IYRGEYNKIVQQADEENHRLRKYLVATDLSDESTHALEWAIGTVLRDGDTLIAIYCVDEETGISTSEESVPDDPK
AMKEQAAAINTVTNAKSSPAPVSPVTELKRVSVLHLRNDSTGTPGSSPGPSGRDRNRADEERRRAIQQMTDKILR
LLRKTRLQVRVIVEVLHCKNPRHLITEVIDLVNPTLVVIGSRGRSALKGVILGSFSNYLVTKSSVPVMVARKRLR
KQNKNNKRTPIRQINNLSNPAARSLANAKID
Coding >Ophio5|7229
ATGGCGGGAGACCCCAGTCGACCTATGAGCATCGATGCCATGCTGGACATGGAGCGTCAGGAGGTGCTGGCTCTC
CTGGAGAATAAGAATCAGGGCCCCAGCTCACCGGAAAGGATACGCCCTTCGTCTCCCTATACCTCGGCGCCGCCC
CGTTCTCCCGTCCGAAGCCTGCTCGACATTGAGGAGGAAGGGCCCAGTGGCACGCGCACAGCTCCCACGACGCAA
GGCCCAGTTCGAAGCATGCTTGATGTGGACACACCCGCGGCCGCGACGCAGCCCCCCGTGCGCAGCATGTTGGAC
ATCGATGCTCCGTCGCCACCGCCCTCGGCCACCTTTCGGAGCTCGAGTCCCGCGTCGCCCGGTCTGGCTGCCCAT
CCCAAGTCGCCCATGTCGCAAGGCTACTTCCCGCGCAGCATGTCGGGTCCGGGTCTGAGGCCCGCCGACCGTGGT
GATCGGACCTCCCAGTATCAGTTCTCGGGCATCCTCTCGCACAACAGCGGCCAGCCTAGGAGGGCTCCGCAGCAC
AGCAAACGGCTTTCAACTGGCTCCCTAGGTGAGGCTATGCGTTCGCCCGACCTGAGCGGCCTCCAGCTCCCCGGT
GAGCGGGGCAGAAACCCATCCATCGGCTCTCGTCTGGGCAACCAGTCCAAGTCGCCTCACGAACGATGGGAGGCC
AGGTCGCGTTCGCCCATGTTCTCGCCCGCCATGTCGCCCAGCAAGGCCATGCTCGGCGACGGCCAGACTTTTGAC
ATCAATAGCGCTTACCGCCGCCTCTCGGATGCGAACCTGGCTGTATCTAGCGGAAGCCTGGCGCAACTTCCACTG
CGGAAACGGACAGAAGAGCTCGGCGAGGGCCGGCTGATCAAAGACTACCTTGGGCCGGATGGCGAGCATCTCGAA
TCCAGCGACGACGACGAGCCGCACTCGTCCGACGACGAGGACCGCGGCCGCAAGACTGCGCCCCGGACGTTGAAC
TCGGACGCGCGAGGCGACAGCGAGCATAGCAAATCACGGTCGCCGTCCGGCCGCGAAGAGCGGCAGAGCTTGAGC
TTGCTTGCCGCGGCCGAACAAGAACGCCTTCAGTTGGCCGCGCAGCCACCCACTTACCAGTACCGATCGCTCATT
CCAGAGCCGGAAATAAAGATTACCAACTCGGCGGGCGATACGTTGAAGTCGCCCAAGCCCGGAATCCATCCCCAT
ACGAGCTATGACCAGGAGCCGCTGTCGGCGACGCCGTCGGGCATCGACTCGGATGACGAGGCCGAGGACGACATC
AAGCGAGCCCAGAAGCTCGCCTTCTCCATGACTAGCATACTGACGAGCCCGGAACAGCACAGGGCCATCCGCATC
ATCTATCGTGGGGAGTACAATAAGATTGTGCAGCAGGCCGATGAAGAGAACCACAGGCTGAGGAAGTACCTGGTA
GCGACAGACCTCAGCGACGAGTCGACGCATGCTCTCGAGTGGGCCATCGGGACGGTGCTTCGGGACGGCGACACG
CTCATCGCCATCTACTGCGTGGATGAGGAGACTGGCATCTCGACAAGCGAGGAGTCGGTGCCCGACGACCCCAAG
GCGATGAAGGAGCAGGCGGCGGCCATCAACACGGTGACGAACGCAAAGTCCAGTCCGGCGCCGGTCAGCCCGGTG
ACGGAGCTCAAGAGGGTGTCGGTGCTGCACCTGCGCAACGACTCGACGGGCACGCCAGGGTCGTCGCCGGGGCCA
TCGGGCCGAGACCGCAACAGGGCAGACGAGGAACGTCGGCGGGCGATTCAGCAGATGACGGATAAGATTCTGCGG
CTACTGAGAAAGACTCGGCTCCAGGTAAGGGTGATTGTCGAGGTGCTTCACTGCAAGAACCCGAGACACCTGATT
ACCGAGGTGATTGACCTCGTGAACCCCACACTGGTTGTCATTGGGAGCCGGGGACGAAGCGCTCTGAAAGGCGTG
ATTCTGGGCTCCTTCTCCAATTACCTGGTGACGAAGAGCTCGGTGCCGGTCATGGTGGCGAGGAAACGGCTGCGG
AAGCAGAACAAGAACAACAAGCGGACGCCCATACGGCAGATTAACAACCTCAGCAATCCGGCGGCGAGGAGTCTG
GCTAATGCCAAGATCGAC
Transcript >Ophio5|7229
ATGGCGGGAGACCCCAGTCGACCTATGAGCATCGATGCCATGCTGGACATGGAGCGTCAGGAGGTGCTGGCTCTC
CTGGAGAATAAGAATCAGGGCCCCAGCTCACCGGAAAGGATACGCCCTTCGTCTCCCTATACCTCGGCGCCGCCC
CGTTCTCCCGTCCGAAGCCTGCTCGACATTGAGGAGGAAGGGCCCAGTGGCACGCGCACAGCTCCCACGACGCAA
GGCCCAGTTCGAAGCATGCTTGATGTGGACACACCCGCGGCCGCGACGCAGCCCCCCGTGCGCAGCATGTTGGAC
ATCGATGCTCCGTCGCCACCGCCCTCGGCCACCTTTCGGAGCTCGAGTCCCGCGTCGCCCGGTCTGGCTGCCCAT
CCCAAGTCGCCCATGTCGCAAGGCTACTTCCCGCGCAGCATGTCGGGTCCGGGTCTGAGGCCCGCCGACCGTGGT
GATCGGACCTCCCAGTATCAGTTCTCGGGCATCCTCTCGCACAACAGCGGCCAGCCTAGGAGGGCTCCGCAGCAC
AGCAAACGGCTTTCAACTGGCTCCCTAGGTGAGGCTATGCGTTCGCCCGACCTGAGCGGCCTCCAGCTCCCCGGT
GAGCGGGGCAGAAACCCATCCATCGGCTCTCGTCTGGGCAACCAGTCCAAGTCGCCTCACGAACGATGGGAGGCC
AGGTCGCGTTCGCCCATGTTCTCGCCCGCCATGTCGCCCAGCAAGGCCATGCTCGGCGACGGCCAGACTTTTGAC
ATCAATAGCGCTTACCGCCGCCTCTCGGATGCGAACCTGGCTGTATCTAGCGGAAGCCTGGCGCAACTTCCACTG
CGGAAACGGACAGAAGAGCTCGGCGAGGGCCGGCTGATCAAAGACTACCTTGGGCCGGATGGCGAGCATCTCGAA
TCCAGCGACGACGACGAGCCGCACTCGTCCGACGACGAGGACCGCGGCCGCAAGACTGCGCCCCGGACGTTGAAC
TCGGACGCGCGAGGCGACAGCGAGCATAGCAAATCACGGTCGCCGTCCGGCCGCGAAGAGCGGCAGAGCTTGAGC
TTGCTTGCCGCGGCCGAACAAGAACGCCTTCAGTTGGCCGCGCAGCCACCCACTTACCAGTACCGATCGCTCATT
CCAGAGCCGGAAATAAAGATTACCAACTCGGCGGGCGATACGTTGAAGTCGCCCAAGCCCGGAATCCATCCCCAT
ACGAGCTATGACCAGGAGCCGCTGTCGGCGACGCCGTCGGGCATCGACTCGGATGACGAGGCCGAGGACGACATC
AAGCGAGCCCAGAAGCTCGCCTTCTCCATGACTAGCATACTGACGAGCCCGGAACAGCACAGGGCCATCCGCATC
ATCTATCGTGGGGAGTACAATAAGATTGTGCAGCAGGCCGATGAAGAGAACCACAGGCTGAGGAAGTACCTGGTA
GCGACAGACCTCAGCGACGAGTCGACGCATGCTCTCGAGTGGGCCATCGGGACGGTGCTTCGGGACGGCGACACG
CTCATCGCCATCTACTGCGTGGATGAGGAGACTGGCATCTCGACAAGCGAGGAGTCGGTGCCCGACGACCCCAAG
GCGATGAAGGAGCAGGCGGCGGCCATCAACACGGTGACGAACGCAAAGTCCAGTCCGGCGCCGGTCAGCCCGGTG
ACGGAGCTCAAGAGGGTGTCGGTGCTGCACCTGCGCAACGACTCGACGGGCACGCCAGGGTCGTCGCCGGGGCCA
TCGGGCCGAGACCGCAACAGGGCAGACGAGGAACGTCGGCGGGCGATTCAGCAGATGACGGATAAGATTCTGCGG
CTACTGAGAAAGACTCGGCTCCAGGTAAGGGTGATTGTCGAGGTGCTTCACTGCAAGAACCCGAGACACCTGATT
ACCGAGGTGATTGACCTCGTGAACCCCACACTGGTTGTCATTGGGAGCCGGGGACGAAGCGCTCTGAAAGGCGTG
ATTCTGGGCTCCTTCTCCAATTACCTGGTGACGAAGAGCTCGGTGCCGGTCATGGTGGCGAGGAAACGGCTGCGG
AAGCAGAACAAGAACAACAAGCGGACGCCCATACGGCAGATTAACAACCTCAGCAATCCGGCGGCGAGGAGTCTG
GCTAATGCCAAGATCGACTGA
Gene >Ophio5|7229
ATGGCGGGAGACCCCAGTCGACCTATGAGCATCGATGCCATGCTGGACATGGAGCGTCAGGAGGTGCTGGCTCTC
CTGGAGAATAAGAATCAGGGCCCCAGCTCACCGGAAAGGATACGCCCTTCGTCTCCCTATACCTCGGCGCCGCCC
CGTTCTCCCGTCCGAAGCCTGCTCGACATTGAGGAGGAAGGGCCCAGTGGCACGCGCACAGCTCCCACGACGCAA
GGCCCAGTTCGAAGCATGCTTGATGTGGACACACCCGCGGCCGCGACGCAGCCCCCCGTGCGCAGCATGTTGGAC
ATCGATGCTCCGTCGCCACCGCCCTCGGCCACCTTTCGGAGCTCGAGTCCCGCGTCGCCCGGTCTGGCTGCCCAT
CCCAAGTCGCCCATGTCGCAAGGCTACTTCCCGCGCAGCATGTCGGGTCCGGGTCTGAGGCCCGCCGACCGTGGT
GATCGGACCTCCCAGTATCAGTTCTCGGGCATCCTCTCGCACAACAGCGGCCAGCCTAGGAGGGCTCCGCAGCAC
AGCAAACGGCTTTCAACTGGCTCCCTAGGTGAGGCTATGCGTTCGCCCGACCTGAGCGGCCTCCAGCTCCCCGGT
GAGCGGGGCAGAAACCCATCCATCGGCTCTCGTCTGGGCAACCAGTCCAAGTCGCCTCACGAACGATGGGAGGCC
AGGTCGCGTTCGCCCATGTTCTCGCCCGCCATGTCGCCCAGCAAGGCCATGCTCGGCGACGGCCAGACTTTTGAC
ATCAATAGCGCTTACCGCCGCCTCTCGGATGCGAACCTGGCTGTATCTAGCGGAAGCCTGGCGCAACTTCCACTG
CGGAAACGGACAGAAGAGCTCGGCGAGGGCCGGCTGATCAAAGACTACCTTGGGCCGGATGGCGAGCATCTCGAA
TCCAGCGACGACGACGAGCCGCACTCGTCCGACGACGAGGACCGCGGCCGCAAGACTGCGCCCCGGACGTTGAAC
TCGGACGCGCGAGGCGACAGCGAGCATAGCAAATCACGGTCGCCGTCCGGCCGCGAAGAGCGGCAGAGCTTGAGC
TTGCTTGCCGCGGCCGAACAAGAACGTACGCTCAGTCCCCTCGTCCTTACACACGAGGGATATAGATTGCTGACG
GCGGAGCAGGCCTTCAGTTGGCCGCGCAGCCACCCACTTACCAGTACCGATCGCTCATTCCAGAGCCGGAAATAA
AGATTACCAACTCGGCGGGCGATACGTTGAAGTCGCCCAAGCCCGGAATCCATCCCCATACGAGCTATGACCAGG
AGCCGCTGTCGGCGACGCCGTCGGGCATCGACTCGGATGACGAGGCCGAGGACGACATCAAGCGAGCCCAGAAGC
TCGCCTTCTCCATGACTAGCATACTGACGAGCCCGGAACAGCACAGGGCCATCCGCATCATCTATCGTGGGGAGT
ACAATAAGATTGTGCAGCAGGCCGATGAAGAGAACCACAGGCTGAGGAAGTACCTGGTAGCGACAGACCTCAGCG
ACGAGTCGACGCATGCTCTCGAGTGGGCCATCGGGACGGTGCTTCGGGACGGCGACACGCTCATCGCCATCTACT
GCGTGGATGAGGAGACTGGCATCTCGACAAGCGAGGAGTCGGTGCCCGACGACCCCAAGGCGATGAAGGAGCAGG
CGGCGGCCATCAACACGGTGACGAACGCAAAGTCCAGTCCGGCGCCGGTCAGCCCGGTGACGGAGCTCAAGAGGG
TGTCGGTGCTGCACCTGCGCAACGACTCGACGGGCACGCCAGGGTCGTCGCCGGGGCCATCGGGCCGAGACCGCA
ACAGGGCAGACGAGGAACGTCGGCGGGCGATTCAGCAGATGACGGATAAGATTCTGCGGCTACTGAGAAAGACTC
GGCTCCAGGTAAGGGTGATTGTCGAGGTGCTTCACTGCAAGAACCCGAGACACCTGATTACCGAGGTGATTGACC
TCGTGAACCCCACACTGGTTGTCATTGGGAGCCGGGGACGAAGCGCTCTGAAAGGGTAAGTGGCCCTGTCCTCTT
ACTCGACGGGATAGGGCTGACGATGAGCAGCGTGATTCTGGGCTCCTTCTCCAATTACCTGGTGACGAAGAGCTC
GGTGCCGGTCATGGTGGCGAGGAAACGGCTGCGGAAGCAGAACAAGAACAACAAGCGGACGCCCATACGGCAGAT
TAACAACCTCAGCAATCCGGCGGCGAGGAGTCTGGCTAATGCCAAGATCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail