Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7220
Gene name
Locationscaffold_681:5889..6720
Strand-
Gene length (bp)831
Transcript length (bp)735
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 8.8E-09 74 139
PF08241 Methyltransf_11 Methyltransferase domain 5.1E-10 73 110
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-09 32 116
PF07021 MetW Methionine biosynthesis protein MetW 7.7E-05 73 105

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 1 241 3.0E-43
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 38 148 2.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7220
MNRKSESATYTHGHHASVLRSHTWRTALNSAAHLLPHLRPDMKMLDIGCGPGTITVDFAGYVPEGHVTGMDRADE
SFDMVVCHQVLQHVKDPVGVLREMRRVTKTGGFVAARESDYGTMVWYPPVQGMESWRALYEKVARWNGGEPDAGR
MLHAWARKAGFSADDVACSSSTWCYSSADEVAWWSGLWAERTVESNFAKTAVEAGLSTEPELRETAEVWRRWGEQ
KDAWFSFLHGEVICRKRGG
Coding >Ophio5|7220
ATGAACCGCAAATCCGAATCGGCCACTTACACCCACGGCCATCATGCGTCCGTTCTTCGGTCTCATACGTGGCGA
ACGGCGCTGAACTCGGCTGCCCATCTTTTGCCCCATCTGCGGCCGGACATGAAGATGCTCGATATCGGCTGCGGC
CCCGGAACCATTACGGTCGATTTCGCCGGCTACGTACCGGAGGGTCATGTCACAGGCATGGATCGAGCAGACGAG
AGCTTCGACATGGTCGTCTGCCACCAAGTTTTGCAACATGTCAAGGACCCCGTCGGCGTCCTGCGCGAGATGAGG
CGCGTAACTAAGACGGGGGGCTTCGTAGCCGCGCGGGAGTCCGACTACGGCACCATGGTTTGGTATCCCCCCGTC
CAAGGCATGGAGAGCTGGCGAGCGCTATACGAAAAGGTGGCCCGGTGGAATGGAGGCGAGCCGGATGCCGGTCGC
ATGCTTCACGCCTGGGCGCGCAAGGCCGGCTTCTCGGCCGACGACGTGGCCTGCAGTTCTAGCACTTGGTGCTAC
AGCTCGGCCGACGAGGTCGCCTGGTGGAGCGGCCTGTGGGCTGAGAGGACGGTCGAGTCCAACTTTGCCAAGACG
GCCGTTGAGGCCGGCCTGTCGACGGAACCTGAGCTCCGGGAGACGGCCGAGGTGTGGAGGAGATGGGGGGAGCAG
AAGGATGCCTGGTTTTCTTTCTTGCACGGGGAGGTGATTTGCCGTAAAAGGGGGGGC
Transcript >Ophio5|7220
ATGAACCGCAAATCCGAATCGGCCACTTACACCCACGGCCATCATGCGTCCGTTCTTCGGTCTCATACGTGGCGA
ACGGCGCTGAACTCGGCTGCCCATCTTTTGCCCCATCTGCGGCCGGACATGAAGATGCTCGATATCGGCTGCGGC
CCCGGAACCATTACGGTCGATTTCGCCGGCTACGTACCGGAGGGTCATGTCACAGGCATGGATCGAGCAGACGAG
AGCTTCGACATGGTCGTCTGCCACCAAGTTTTGCAACATGTCAAGGACCCCGTCGGCGTCCTGCGCGAGATGAGG
CGCGTAACTAAGACGGGGGGCTTCGTAGCCGCGCGGGAGTCCGACTACGGCACCATGGTTTGGTATCCCCCCGTC
CAAGGCATGGAGAGCTGGCGAGCGCTATACGAAAAGGTGGCCCGGTGGAATGGAGGCGAGCCGGATGCCGGTCGC
ATGCTTCACGCCTGGGCGCGCAAGGCCGGCTTCTCGGCCGACGACGTGGCCTGCAGTTCTAGCACTTGGTGCTAC
AGCTCGGCCGACGAGGTCGCCTGGTGGAGCGGCCTGTGGGCTGAGAGGACGGTCGAGTCCAACTTTGCCAAGACG
GCCGTTGAGGCCGGCCTGTCGACGGAACCTGAGCTCCGGGAGACGGCCGAGGTGTGGAGGAGATGGGGGGAGCAG
AAGGATGCCTGGTTTTCTTTCTTGCACGGGGAGGTGATTTGCCGTAAAAGGGGGGGCTGA
Gene >Ophio5|7220
ATGAACCGCAAATCCGAATCGGCCACTTACACCCACGGCCATCATGCGTCCGTTCTTCGGTCTCATACGTGGCGA
ACGGCGCTGAACTCGGCTGCCCATCTTTTGCCCCATCTGCGGCCGGACATGAAGATGCTCGATATCGGCTGCGGC
CCCGGAACCATTACGGTCGATTTCGCCGGCTACGTACCGGAGGGTCATGTCACAGGCATGGATCGAGCAGGTCAA
GTGCTCGACCAAGCGCGTGCTCTGGCAGCGGAGCGAGGCCTAACGAACATTGACTTCGTCGAGGGAGACGCAAAC
GGTCTAGACTACGCAGACGAGAGCTTCGACATGGTCGTCTGCCACCAAGTTTTGCAACATGTCAAGGACCCCGTC
GGCGTCCTGCGCGAGATGAGGCGCGTAACTAAGACGGGGGGCTTCGTAGCCGCGCGGGAGTCCGACTACGGCACC
ATGGTTTGGTATCCCCCCGTCCAAGGCATGGAGAGCTGGCGAGCGCTATACGAAAAGGTGGCCCGGTGGAATGGA
GGCGAGCCGGATGCCGGTCGCATGCTTCACGCCTGGGCGCGCAAGGCCGGCTTCTCGGCCGACGACGTGGCCTGC
AGTTCTAGCACTTGGTGCTACAGCTCGGCCGACGAGGTCGCCTGGTGGAGCGGCCTGTGGGCTGAGAGGACGGTC
GAGTCCAACTTTGCCAAGACGGCCGTTGAGGCCGGCCTGTCGACGGAACCTGAGCTCCGGGAGACGGCCGAGGTG
TGGAGGAGATGGGGGGAGCAGAAGGATGCCTGGTTTTCTTTCTTGCACGGGGAGGTGATTTGCCGTAAAAGGGGG
GGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail