Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7211
Gene name
Locationscaffold_68:41230..43523
Strand+
Gene length (bp)2293
Transcript length (bp)2238
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.3E-158 53 704

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 2 745 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 29 745 2.0E-175
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 22 745 2.0E-146
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 31 741 4.0E-142
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 20 715 2.0E-137
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 2 745 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 29 745 2.0E-175
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 22 745 2.0E-146
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 31 741 4.0E-142
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 20 715 2.0E-137
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 26 716 4.0E-134
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 33 735 2.0E-132
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 27 734 6.0E-131
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 3 715 6.0E-131
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 31 716 5.0E-130
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 21 716 3.0E-127
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 9 738 1.0E-126
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 2 745 5.0E-104
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 33 725 3.0E-102
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 86 108 22
3 128 150 22
4 160 182 22
5 187 209 22
6 224 246 22
7 266 288 22
8 303 325 22
9 366 388 22
10 427 446 19
11 453 475 22
12 485 507 22
13 537 559 22
14 579 598 19
15 607 629 22
16 644 666 22
17 686 708 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7211
MSDETPAKIDNIEPDAAIVLDVFEPDSPALEDSPYEEVRAAVRNLDGGEAANSLRAWLIGLFFVTLGTGLHMFLS
MRSPAISLPPIVVQLLAYPMGCLWARLVPNRVFTTFGRRWTLNPGPFTIKEHVVISLMSNVSIGGAYSTDALVAM
RARPFFNLDFGWGFALLFTLSSQLVGIALAGLFRHFLVLPAAMVWSRQFASCALFYALHDRSPTPGWRISRYRWF
AAVAAAMFCYSWLPAVVWRGLSVFAFITWIRPRSPVVNQLFGGFSGLSLLPFTLDWTYVTAYLGDPLLAPTTSHL
NTLVGLVLFVVIACIVMVFTGALYADYLPVVSANTYDNRQGLYDATRVLGPGLTFDERRYRRYSPLFLPPALALN
YGLSFAALTSALVHMWLHQRRDLWHRFRASRDQQQPDVHAKLMARYADAPDWWYAALLVVSLGLSLATALGYDSQ
LPWWALVASISLAVLFIIPVTTVLAVYNIMLGLNVLAPFLAGFILPGRPVGVAMFNVYSTVVLLQAQTYSGDLKL
GHYMKVPPRITFWCQVVATVWAVFVQVAVMNWTLGHVNGVCDNMQPDHFSCPNGRAFFSATVVLGLVGPRRLFGT
GGLYAHLNWFWLLGAALPLLLYGLARISATRFLGRLQAPVMLGAMAWLPPGTPLSYSTWAVVGLIFNGWIRKRWK
GWWRTYNYTTAAALDSGLILATIVVFFAITWPGRELRWWGNVAVFDTLDAKHAATLKTVPEGKTFGPAAW
Coding >Ophio5|7211
ATGAGCGATGAGACGCCCGCCAAAATCGATAACATTGAGCCAGATGCGGCAATCGTGCTCGACGTCTTTGAGCCA
GACTCGCCGGCCCTCGAGGACTCGCCATACGAAGAGGTGCGCGCCGCCGTACGCAACTTGGACGGCGGCGAGGCT
GCCAATTCGCTGAGAGCCTGGCTCATCGGCCTGTTCTTCGTTACCCTCGGCACCGGCCTTCACATGTTTCTGTCC
ATGAGGAGTCCTGCCATCAGCCTGCCGCCCATCGTCGTCCAGCTTCTCGCATACCCCATGGGCTGCCTCTGGGCC
AGACTTGTCCCCAATCGCGTCTTCACCACCTTTGGCCGACGCTGGACCCTCAATCCCGGCCCCTTTACCATCAAG
GAGCATGTCGTTATATCGCTCATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACCGACGCCCTCGTCGCCATG
CGCGCCCGGCCCTTCTTTAACCTTGATTTCGGTTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCACAGCTCGTC
GGCATCGCTTTGGCCGGCCTCTTCCGCCACTTTCTCGTCCTGCCCGCTGCCATGGTCTGGTCCCGCCAGTTCGCC
AGCTGCGCCCTCTTCTACGCTCTCCACGATCGAAGTCCGACCCCCGGCTGGCGCATTAGTCGCTATCGCTGGTTC
GCCGCTGTCGCTGCCGCCATGTTCTGCTACTCGTGGCTGCCGGCCGTCGTGTGGCGCGGCCTATCCGTCTTTGCC
TTCATCACCTGGATACGGCCTCGCAGCCCTGTCGTGAACCAGCTCTTTGGCGGCTTCTCTGGCCTCTCGCTGCTC
CCCTTCACCCTGGACTGGACCTACGTCACTGCCTACCTCGGTGACCCGCTACTCGCCCCTACAACCTCCCACCTA
AACACGCTTGTCGGCCTTGTACTCTTCGTCGTCATCGCCTGCATCGTCATGGTCTTCACCGGTGCCCTCTATGCC
GACTATCTTCCTGTCGTCTCGGCCAACACATACGACAACCGCCAAGGCCTGTACGACGCCACCCGTGTCCTTGGG
CCCGGCTTGACGTTTGACGAGCGCCGCTACCGCCGCTACTCGCCCCTGTTTCTTCCGCCCGCCCTTGCCCTCAAT
TACGGCCTATCCTTTGCCGCTCTGACATCGGCTCTCGTCCACATGTGGCTACACCAGCGTCGCGACCTCTGGCAT
CGCTTCCGCGCCTCCCGCGACCAGCAGCAGCCCGACGTCCATGCCAAGCTAATGGCACGTTACGCCGACGCCCCG
GACTGGTGGTACGCTGCCCTGCTGGTCGTCTCGCTCGGCCTCAGCCTGGCGACGGCGCTGGGCTACGACTCGCAG
CTGCCTTGGTGGGCTCTAGTCGCCTCCATCAGCCTCGCCGTTCTCTTCATTATCCCAGTTACCACGGTCTTGGCC
GTGTACAACATCATGCTCGGCCTCAATGTCCTCGCTCCCTTTCTCGCCGGCTTCATTCTCCCCGGCCGACCTGTT
GGCGTCGCCATGTTCAATGTCTACAGCACTGTCGTTCTCCTGCAGGCTCAGACATACAGCGGCGATCTCAAGTTA
GGCCATTACATGAAGGTGCCCCCTCGGATTACCTTCTGGTGCCAGGTTGTTGCCACCGTCTGGGCCGTCTTCGTC
CAGGTGGCCGTCATGAACTGGACTCTCGGCCACGTCAACGGCGTGTGCGACAACATGCAGCCGGACCACTTCTCC
TGTCCCAACGGCCGGGCCTTTTTTTCCGCCACCGTCGTCTTGGGCCTCGTCGGTCCGCGCCGCCTGTTCGGCACC
GGCGGCCTGTACGCTCACCTCAACTGGTTTTGGCTCCTCGGCGCCGCCCTGCCGCTACTGCTATACGGCCTTGCT
CGGATTTCCGCGACACGCTTCTTGGGCCGTTTGCAAGCACCCGTCATGCTGGGCGCCATGGCGTGGCTGCCCCCG
GGGACGCCCCTCAGCTACTCAACCTGGGCCGTTGTCGGACTCATCTTCAACGGTTGGATCCGAAAGAGGTGGAAG
GGCTGGTGGAGGACGTACAACTACACGACAGCAGCCGCCCTCGACTCGGGCCTGATTCTGGCCACCATCGTCGTC
TTCTTCGCCATCACTTGGCCGGGGCGCGAGCTGCGGTGGTGGGGCAACGTGGCTGTCTTCGACACGCTCGACGCC
AAGCACGCCGCTACTCTCAAGACGGTCCCGGAGGGAAAGACGTTTGGGCCAGCGGCATGG
Transcript >Ophio5|7211
ATGAGCGATGAGACGCCCGCCAAAATCGATAACATTGAGCCAGATGCGGCAATCGTGCTCGACGTCTTTGAGCCA
GACTCGCCGGCCCTCGAGGACTCGCCATACGAAGAGGTGCGCGCCGCCGTACGCAACTTGGACGGCGGCGAGGCT
GCCAATTCGCTGAGAGCCTGGCTCATCGGCCTGTTCTTCGTTACCCTCGGCACCGGCCTTCACATGTTTCTGTCC
ATGAGGAGTCCTGCCATCAGCCTGCCGCCCATCGTCGTCCAGCTTCTCGCATACCCCATGGGCTGCCTCTGGGCC
AGACTTGTCCCCAATCGCGTCTTCACCACCTTTGGCCGACGCTGGACCCTCAATCCCGGCCCCTTTACCATCAAG
GAGCATGTCGTTATATCGCTCATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACCGACGCCCTCGTCGCCATG
CGCGCCCGGCCCTTCTTTAACCTTGATTTCGGTTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCACAGCTCGTC
GGCATCGCTTTGGCCGGCCTCTTCCGCCACTTTCTCGTCCTGCCCGCTGCCATGGTCTGGTCCCGCCAGTTCGCC
AGCTGCGCCCTCTTCTACGCTCTCCACGATCGAAGTCCGACCCCCGGCTGGCGCATTAGTCGCTATCGCTGGTTC
GCCGCTGTCGCTGCCGCCATGTTCTGCTACTCGTGGCTGCCGGCCGTCGTGTGGCGCGGCCTATCCGTCTTTGCC
TTCATCACCTGGATACGGCCTCGCAGCCCTGTCGTGAACCAGCTCTTTGGCGGCTTCTCTGGCCTCTCGCTGCTC
CCCTTCACCCTGGACTGGACCTACGTCACTGCCTACCTCGGTGACCCGCTACTCGCCCCTACAACCTCCCACCTA
AACACGCTTGTCGGCCTTGTACTCTTCGTCGTCATCGCCTGCATCGTCATGGTCTTCACCGGTGCCCTCTATGCC
GACTATCTTCCTGTCGTCTCGGCCAACACATACGACAACCGCCAAGGCCTGTACGACGCCACCCGTGTCCTTGGG
CCCGGCTTGACGTTTGACGAGCGCCGCTACCGCCGCTACTCGCCCCTGTTTCTTCCGCCCGCCCTTGCCCTCAAT
TACGGCCTATCCTTTGCCGCTCTGACATCGGCTCTCGTCCACATGTGGCTACACCAGCGTCGCGACCTCTGGCAT
CGCTTCCGCGCCTCCCGCGACCAGCAGCAGCCCGACGTCCATGCCAAGCTAATGGCACGTTACGCCGACGCCCCG
GACTGGTGGTACGCTGCCCTGCTGGTCGTCTCGCTCGGCCTCAGCCTGGCGACGGCGCTGGGCTACGACTCGCAG
CTGCCTTGGTGGGCTCTAGTCGCCTCCATCAGCCTCGCCGTTCTCTTCATTATCCCAGTTACCACGGTCTTGGCC
GTGTACAACATCATGCTCGGCCTCAATGTCCTCGCTCCCTTTCTCGCCGGCTTCATTCTCCCCGGCCGACCTGTT
GGCGTCGCCATGTTCAATGTCTACAGCACTGTCGTTCTCCTGCAGGCTCAGACATACAGCGGCGATCTCAAGTTA
GGCCATTACATGAAGGTGCCCCCTCGGATTACCTTCTGGTGCCAGGTTGTTGCCACCGTCTGGGCCGTCTTCGTC
CAGGTGGCCGTCATGAACTGGACTCTCGGCCACGTCAACGGCGTGTGCGACAACATGCAGCCGGACCACTTCTCC
TGTCCCAACGGCCGGGCCTTTTTTTCCGCCACCGTCGTCTTGGGCCTCGTCGGTCCGCGCCGCCTGTTCGGCACC
GGCGGCCTGTACGCTCACCTCAACTGGTTTTGGCTCCTCGGCGCCGCCCTGCCGCTACTGCTATACGGCCTTGCT
CGGATTTCCGCGACACGCTTCTTGGGCCGTTTGCAAGCACCCGTCATGCTGGGCGCCATGGCGTGGCTGCCCCCG
GGGACGCCCCTCAGCTACTCAACCTGGGCCGTTGTCGGACTCATCTTCAACGGTTGGATCCGAAAGAGGTGGAAG
GGCTGGTGGAGGACGTACAACTACACGACAGCAGCCGCCCTCGACTCGGGCCTGATTCTGGCCACCATCGTCGTC
TTCTTCGCCATCACTTGGCCGGGGCGCGAGCTGCGGTGGTGGGGCAACGTGGCTGTCTTCGACACGCTCGACGCC
AAGCACGCCGCTACTCTCAAGACGGTCCCGGAGGGAAAGACGTTTGGGCCAGCGGCATGGTGA
Gene >Ophio5|7211
ATGAGCGATGAGACGCCCGCCAAAATCGATAACATTGAGCCAGATGCGGCAATCGTGCTCGACGTCTTTGAGCCA
GACTCGCCGGCCCTCGAGGACTCGCCATACGAAGAGGTGCGCGCCGCCGTACGCAACTTGGACGGCGGCGAGGCT
GCCAATTCGCTGAGAGCCTGGCTCATCGGCCTGTTCTTCGTTACCCTCGGCACCGGCCTTCACATGTTTCTGTCC
ATGAGGTGAGGGCTTCAATTGGATGGCGCGCAGCCTGACGCTCACTTTGTCGTCGCATAGGAGTCCTGCCATCAG
CCTGCCGCCCATCGTCGTCCAGCTTCTCGCATACCCCATGGGCTGCCTCTGGGCCAGACTTGTCCCCAATCGCGT
CTTCACCACCTTTGGCCGACGCTGGACCCTCAATCCCGGCCCCTTTACCATCAAGGAGCATGTCGTTATATCGCT
CATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACCGACGCCCTCGTCGCCATGCGCGCCCGGCCCTTCTTTAA
CCTTGATTTCGGTTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCACAGCTCGTCGGCATCGCTTTGGCCGGCCT
CTTCCGCCACTTTCTCGTCCTGCCCGCTGCCATGGTCTGGTCCCGCCAGTTCGCCAGCTGCGCCCTCTTCTACGC
TCTCCACGATCGAAGTCCGACCCCCGGCTGGCGCATTAGTCGCTATCGCTGGTTCGCCGCTGTCGCTGCCGCCAT
GTTCTGCTACTCGTGGCTGCCGGCCGTCGTGTGGCGCGGCCTATCCGTCTTTGCCTTCATCACCTGGATACGGCC
TCGCAGCCCTGTCGTGAACCAGCTCTTTGGCGGCTTCTCTGGCCTCTCGCTGCTCCCCTTCACCCTGGACTGGAC
CTACGTCACTGCCTACCTCGGTGACCCGCTACTCGCCCCTACAACCTCCCACCTAAACACGCTTGTCGGCCTTGT
ACTCTTCGTCGTCATCGCCTGCATCGTCATGGTCTTCACCGGTGCCCTCTATGCCGACTATCTTCCTGTCGTCTC
GGCCAACACATACGACAACCGCCAAGGCCTGTACGACGCCACCCGTGTCCTTGGGCCCGGCTTGACGTTTGACGA
GCGCCGCTACCGCCGCTACTCGCCCCTGTTTCTTCCGCCCGCCCTTGCCCTCAATTACGGCCTATCCTTTGCCGC
TCTGACATCGGCTCTCGTCCACATGTGGCTACACCAGCGTCGCGACCTCTGGCATCGCTTCCGCGCCTCCCGCGA
CCAGCAGCAGCCCGACGTCCATGCCAAGCTAATGGCACGTTACGCCGACGCCCCGGACTGGTGGTACGCTGCCCT
GCTGGTCGTCTCGCTCGGCCTCAGCCTGGCGACGGCGCTGGGCTACGACTCGCAGCTGCCTTGGTGGGCTCTAGT
CGCCTCCATCAGCCTCGCCGTTCTCTTCATTATCCCAGTTACCACGGTCTTGGCCGTGTACAACATCATGCTCGG
CCTCAATGTCCTCGCTCCCTTTCTCGCCGGCTTCATTCTCCCCGGCCGACCTGTTGGCGTCGCCATGTTCAATGT
CTACAGCACTGTCGTTCTCCTGCAGGCTCAGACATACAGCGGCGATCTCAAGTTAGGCCATTACATGAAGGTGCC
CCCTCGGATTACCTTCTGGTGCCAGGTTGTTGCCACCGTCTGGGCCGTCTTCGTCCAGGTGGCCGTCATGAACTG
GACTCTCGGCCACGTCAACGGCGTGTGCGACAACATGCAGCCGGACCACTTCTCCTGTCCCAACGGCCGGGCCTT
TTTTTCCGCCACCGTCGTCTTGGGCCTCGTCGGTCCGCGCCGCCTGTTCGGCACCGGCGGCCTGTACGCTCACCT
CAACTGGTTTTGGCTCCTCGGCGCCGCCCTGCCGCTACTGCTATACGGCCTTGCTCGGATTTCCGCGACACGCTT
CTTGGGCCGTTTGCAAGCACCCGTCATGCTGGGCGCCATGGCGTGGCTGCCCCCGGGGACGCCCCTCAGCTACTC
AACCTGGGCCGTTGTCGGACTCATCTTCAACGGTTGGATCCGAAAGAGGTGGAAGGGCTGGTGGAGGACGTACAA
CTACACGACAGCAGCCGCCCTCGACTCGGGCCTGATTCTGGCCACCATCGTCGTCTTCTTCGCCATCACTTGGCC
GGGGCGCGAGCTGCGGTGGTGGGGCAACGTGGCTGTCTTCGACACGCTCGACGCCAAGCACGCCGCTACTCTCAA
GACGGTCCCGGAGGGAAAGACGTTTGGGCCAGCGGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail