Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7203
Gene name
Locationscaffold_68:21106..22403
Strand-
Gene length (bp)1297
Transcript length (bp)1038
Coding sequence length (bp)1035
Protein length (aa) 345

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6246 0.4719 0.1486 0.1063 0.2738 0.0188 0.1558 0.0825 0.1267 0.0286

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7841
Ophiocordyceps australis map64 (Brazil) OphauB2|6467
Ophiocordyceps camponoti-floridani Ophcf2|03894
Ophiocordyceps camponoti-rufipedis Ophun1|4836
Ophiocordyceps kimflemingae Ophio5|7203 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7203
MPNLAIPIIPASLREAAMPSANPGPSPSPSPGLEIGYRPTPDDIVILRAALNRAKGLPPDIVDCIFDHAEYWAHS
SAVVDYGSELRHSLRIAGTGAQENTFLLRSPPLGLTHLCRGDARLAEELVYDSSEARPLPLAKEHDAAFFARLAN
YSTPRLANPARKIVFTIRSHDQGWGNSDDDDPYASSWTWFEAGLERLDALQECDAKCTYDACRESSTEKCPALPV
CGLRPIHPSTILSDADDQPRYLYHHPLLPDDRHNIRRNKAASRDWQDHVITWSYLDDIEPTSDAGAELHRQGRGR
ASGDGGLTRLSRSASTSTGLCDEELRCYFSLRFSMHFDAATPGIR
Coding >Ophio5|7203
ATGCCTAACCTTGCCATCCCCATTATTCCCGCCAGCCTCCGAGAAGCCGCCATGCCGTCCGCCAACCCCGGCCCC
AGCCCCAGCCCCAGCCCTGGCCTCGAGATCGGCTATCGCCCTACGCCCGACGACATAGTCATCTTGCGCGCGGCC
CTAAACCGCGCCAAGGGCCTTCCGCCGGACATTGTTGACTGCATCTTCGACCATGCGGAGTACTGGGCTCATTCG
TCTGCTGTTGTCGATTACGGCTCGGAGCTACGACATAGTCTACGCATCGCTGGGACCGGCGCCCAGGAGAACACA
TTTCTCCTTCGCTCGCCGCCTCTCGGCCTGACGCATCTTTGTCGCGGTGACGCTCGTCTGGCAGAGGAGCTCGTC
TACGACTCTAGCGAGGCGCGGCCTTTACCACTGGCCAAGGAACACGACGCTGCCTTCTTCGCCCGTTTGGCCAAC
TACTCGACGCCGAGACTTGCCAATCCGGCTCGCAAGATTGTCTTCACCATCAGAAGCCACGACCAGGGCTGGGGC
AACAGTGATGACGATGATCCGTACGCCAGCTCCTGGACCTGGTTTGAGGCTGGCCTTGAGCGCCTTGATGCTTTG
CAGGAGTGCGACGCAAAGTGCACCTACGACGCTTGCCGCGAGTCTTCCACCGAAAAGTGCCCCGCTCTCCCCGTT
TGTGGCCTCCGTCCCATCCACCCATCCACCATTCTCTCCGACGCCGACGACCAGCCTCGATACCTGTACCATCAT
CCGCTGCTCCCCGACGACCGCCATAACATACGTCGCAACAAGGCCGCCTCGCGCGACTGGCAAGATCACGTCATC
ACATGGTCCTACCTCGACGACATCGAGCCCACCTCTGACGCTGGCGCCGAGCTGCATCGGCAGGGTCGCGGACGT
GCTTCGGGAGACGGTGGGTTAACACGGTTGAGTCGGTCCGCATCGACGTCTACTGGGCTGTGTGACGAGGAACTC
AGATGCTATTTCTCATTACGTTTCTCCATGCATTTCGACGCAGCAACACCCGGGATACGA
Transcript >Ophio5|7203
ATGCCTAACCTTGCCATCCCCATTATTCCCGCCAGCCTCCGAGAAGCCGCCATGCCGTCCGCCAACCCCGGCCCC
AGCCCCAGCCCCAGCCCTGGCCTCGAGATCGGCTATCGCCCTACGCCCGACGACATAGTCATCTTGCGCGCGGCC
CTAAACCGCGCCAAGGGCCTTCCGCCGGACATTGTTGACTGCATCTTCGACCATGCGGAGTACTGGGCTCATTCG
TCTGCTGTTGTCGATTACGGCTCGGAGCTACGACATAGTCTACGCATCGCTGGGACCGGCGCCCAGGAGAACACA
TTTCTCCTTCGCTCGCCGCCTCTCGGCCTGACGCATCTTTGTCGCGGTGACGCTCGTCTGGCAGAGGAGCTCGTC
TACGACTCTAGCGAGGCGCGGCCTTTACCACTGGCCAAGGAACACGACGCTGCCTTCTTCGCCCGTTTGGCCAAC
TACTCGACGCCGAGACTTGCCAATCCGGCTCGCAAGATTGTCTTCACCATCAGAAGCCACGACCAGGGCTGGGGC
AACAGTGATGACGATGATCCGTACGCCAGCTCCTGGACCTGGTTTGAGGCTGGCCTTGAGCGCCTTGATGCTTTG
CAGGAGTGCGACGCAAAGTGCACCTACGACGCTTGCCGCGAGTCTTCCACCGAAAAGTGCCCCGCTCTCCCCGTT
TGTGGCCTCCGTCCCATCCACCCATCCACCATTCTCTCCGACGCCGACGACCAGCCTCGATACCTGTACCATCAT
CCGCTGCTCCCCGACGACCGCCATAACATACGTCGCAACAAGGCCGCCTCGCGCGACTGGCAAGATCACGTCATC
ACATGGTCCTACCTCGACGACATCGAGCCCACCTCTGACGCTGGCGCCGAGCTGCATCGGCAGGGTCGCGGACGT
GCTTCGGGAGACGGTGGGTTAACACGGTTGAGTCGGTCCGCATCGACGTCTACTGGGCTGTGTGACGAGGAACTC
AGATGCTATTTCTCATTACGTTTCTCCATGCATTTCGACGCAGCAACACCCGGGATACGATAG
Gene >Ophio5|7203
ATGCCTAACCTTGCCATCCCCATTATTCCCGCCAGCCTCCGAGAAGCCGCCATGCCGTCCGCCAACCCCGGCCCC
AGCCCCAGCCCCAGCCCTGGCCTCGAGATCGGCTATCGCCCTACGCCCGACGACATAGTCATCTTGCGCGCGGCC
CTAAACCGCGCCAAGGGCCTTCCGCCGGACATTGTTGACTGCATCTTCGACCATGCGGAGTACTGGGCTCATTCG
TCTGCTGTTGTCGATTACGGCTCGGAGCTACGACATAGTCTACGCATCGCTGGGACCGGCGCCCAGGAGAACACA
TTTCTCGTCAGTGGGGGCTTACTTGTCGATACGCGTCGAATCCTGAAGCTGACGGTCTATGAAAATAGCTTCGCT
CGCCGCCTCTCGGCCTGACGCATCTTTGTCGCGGTGACGCTCGTCTGGCAGAGGAGCTCGTCTACGACTCTAGCG
AGGCGCGGCCTTTACCACTGGCCAAGGAACACGACGCTGCCTTCTTCGCCCGTTTGGCCAACTACTCGACGCCGA
GACTTGCCAATCCGGCTCGCAAGATTGTCTTCACCATCAGAAGCCACGACCAGGGCTGGGGCAACAGTGATGACG
ATGATCCGTACGCCAGCTCCTGGACCTGGTTTGAGGCTGGCCTTGAGCGCCTTGATGCTTTGCAGGAGTGCAAGT
CCCCCTCCGTCTTCGCCTGATCCAATGTCTCGGACCGTGAAACCTCGCTGACCTTGTGTTCAGGCGACGCAAAGT
GCACCTACGACGCTTGCCGCGAGTCTTCCACCGAAAAGTGCCCCGCTCTCCCCGTTTGTGGCCTCCGTCCCATCC
ACCCATCCACCATTCTCTCCGACGCCGACGACCAGCCTCGATACCTGTACCATCATCCGCTGCTCCCCGACGACC
GCCATAACATACGTCGCAACAAGGCCGCCTCGCGCGACTGGCAAGATCACGTCATCACATGGTCCTACCTCGACG
ACATCGAGCCCACCTCTGACGCTGGCGCCGAGCTGCATCGGCAGGGTCGCGGACGTGCTTCGGGAGACGGGTCAT
TTGTGCGCGGCTTGAAACTCGGCGATGTCGTTACCGTTTGGGGCAAGGCTCGCTTCCCGCAGTGGGTTAACACGG
TTGAGTCGGTCCGCATCGACGTCTACTGGGCTGTGTGACGGTATGCATTGTCATCTGAGCATCGGGCGGCCTCGA
CTCACTCACCGTGTTCTGTGGACAAGAGGAACTCAGATGCTATTTCTCATTACGTTTCTCCATGCATTTCGACGC
AGCAACACCCGGGATACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail