Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7183
Gene name
Locationscaffold_676:4427..5767
Strand-
Gene length (bp)1340
Transcript length (bp)1134
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10058 zinc_ribbon_10 Predicted integral membrane zinc-ribbon metal-binding protein 1.2E-19 258 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PFM4|LNPB_DANRE Protein lunapark-B OS=Danio rerio GN=lnpb PE=2 SV=2 7 314 5.0E-10
sp|Q9C0E8|LNP_HUMAN Protein lunapark OS=Homo sapiens GN=LNP PE=1 SV=2 35 314 2.0E-09
sp|Q7TQ95|LNP_MOUSE Protein lunapark OS=Mus musculus GN=Lnp PE=1 SV=1 35 314 2.0E-08
sp|Q5R891|LNP_PONAB Protein lunapark OS=Pongo abelii GN=LNP PE=2 SV=1 4 314 3.0E-08
sp|Q6DFJ8|LNP_XENLA Protein lunapark OS=Xenopus laevis GN=lnp PE=2 SV=1 20 314 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PFM4|LNPB_DANRE Protein lunapark-B OS=Danio rerio GN=lnpb PE=2 SV=2 7 314 5.0E-10
sp|Q9C0E8|LNP_HUMAN Protein lunapark OS=Homo sapiens GN=LNP PE=1 SV=2 35 314 2.0E-09
sp|Q7TQ95|LNP_MOUSE Protein lunapark OS=Mus musculus GN=Lnp PE=1 SV=1 35 314 2.0E-08
sp|Q5R891|LNP_PONAB Protein lunapark OS=Pongo abelii GN=LNP PE=2 SV=1 4 314 3.0E-08
sp|Q6DFJ8|LNP_XENLA Protein lunapark OS=Xenopus laevis GN=lnp PE=2 SV=1 20 314 3.0E-06
sp|Q1KKR9|LNPB_TAKRU Protein lunapark-B OS=Takifugu rubripes GN=lnpb PE=3 SV=1 85 314 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 79 101 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7183
MVSFWPWKGDVSSPASFEKTLSALSVKIADSQSRLDRGRNSARRTKALWTLYLSFAYVVYAIVLLLVVGHRNLGA
YEWTGMAGGPVLIYGTRALIAALFGFHIDRLADRLRDQLETRAKTIQKLKDATKYDSTMELIEKYGGPNRSRSRT
ADSGSDSEANRKKMTTTAVPNRTSMPPPPTANIARTQHQGPPIRLPATPPAPSKQQQQQQQPAAAAAAAAAPQQP
SSSPDVVASDTADFAPNAFSSHASYAHPDSRHWYDRILDVLLGEDEAAPKNRIVLICRACRLVNGQAPPGTKSLV
ELGSWRCMACNALNDDDDDDDDDDGHDDGHDDGHDLVPTVHPPRHSSLSPPSPPPPPDHQQDDADDAHDPFRPDG
PG
Coding >Ophio5|7183
ATGGTGTCGTTTTGGCCCTGGAAGGGCGACGTCTCCTCTCCCGCCTCGTTCGAAAAGACGCTCTCGGCCCTCTCC
GTTAAGATCGCCGACTCCCAGTCCCGGCTTGATCGAGGTCGCAACAGCGCTCGCCGCACAAAAGCCCTCTGGACT
CTGTATCTGTCTTTTGCCTACGTCGTCTACGCCATCGTCCTGTTACTCGTCGTCGGTCATCGCAACCTAGGCGCA
TACGAATGGACCGGCATGGCAGGCGGGCCCGTCCTAATATACGGCACCCGCGCCCTCATTGCCGCCCTCTTTGGC
TTTCACATCGACCGGCTCGCAGACCGGCTAAGGGACCAGCTCGAGACGCGCGCAAAGACGATCCAAAAGCTCAAG
GATGCCACCAAGTACGATTCCACCATGGAGCTCATCGAAAAATACGGCGGACCCAATCGTTCTCGCAGCCGAACT
GCCGACTCCGGTTCCGACTCGGAAGCCAACCGCAAGAAGATGACAACAACAGCCGTCCCTAACCGAACCTCAATG
CCTCCCCCCCCAACCGCCAACATCGCTCGCACCCAACACCAAGGTCCTCCCATCCGTCTCCCCGCCACGCCCCCT
GCGCCGTCGAAACAACAACAACAACAACAACAACCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCGCAGCAACCC
TCCTCCTCCCCGGACGTCGTCGCCTCCGACACCGCCGACTTCGCGCCCAACGCCTTCAGCAGCCACGCCTCGTAC
GCCCACCCGGACTCGCGCCACTGGTACGATCGCATCTTGGACGTCCTCCTCGGCGAGGACGAAGCGGCGCCCAAG
AACCGCATCGTCCTCATCTGTCGCGCCTGTCGTCTGGTCAACGGCCAGGCCCCCCCCGGTACAAAGTCCCTCGTC
GAGCTCGGCTCTTGGCGCTGCATGGCCTGCAACGCCCTCAACGACGACGACGATGATGATGATGATGATGATGGC
CATGATGACGGCCATGATGACGGCCATGACCTCGTCCCCACCGTCCATCCGCCGAGACACTCTTCACTCTCTCCT
CCTTCCCCCCCCCCTCCTCCCGACCACCAACAAGATGATGCCGACGACGCCCATGATCCATTCAGGCCAGATGGC
CCCGGC
Transcript >Ophio5|7183
ATGGTGTCGTTTTGGCCCTGGAAGGGCGACGTCTCCTCTCCCGCCTCGTTCGAAAAGACGCTCTCGGCCCTCTCC
GTTAAGATCGCCGACTCCCAGTCCCGGCTTGATCGAGGTCGCAACAGCGCTCGCCGCACAAAAGCCCTCTGGACT
CTGTATCTGTCTTTTGCCTACGTCGTCTACGCCATCGTCCTGTTACTCGTCGTCGGTCATCGCAACCTAGGCGCA
TACGAATGGACCGGCATGGCAGGCGGGCCCGTCCTAATATACGGCACCCGCGCCCTCATTGCCGCCCTCTTTGGC
TTTCACATCGACCGGCTCGCAGACCGGCTAAGGGACCAGCTCGAGACGCGCGCAAAGACGATCCAAAAGCTCAAG
GATGCCACCAAGTACGATTCCACCATGGAGCTCATCGAAAAATACGGCGGACCCAATCGTTCTCGCAGCCGAACT
GCCGACTCCGGTTCCGACTCGGAAGCCAACCGCAAGAAGATGACAACAACAGCCGTCCCTAACCGAACCTCAATG
CCTCCCCCCCCAACCGCCAACATCGCTCGCACCCAACACCAAGGTCCTCCCATCCGTCTCCCCGCCACGCCCCCT
GCGCCGTCGAAACAACAACAACAACAACAACAACCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCGCAGCAACCC
TCCTCCTCCCCGGACGTCGTCGCCTCCGACACCGCCGACTTCGCGCCCAACGCCTTCAGCAGCCACGCCTCGTAC
GCCCACCCGGACTCGCGCCACTGGTACGATCGCATCTTGGACGTCCTCCTCGGCGAGGACGAAGCGGCGCCCAAG
AACCGCATCGTCCTCATCTGTCGCGCCTGTCGTCTGGTCAACGGCCAGGCCCCCCCCGGTACAAAGTCCCTCGTC
GAGCTCGGCTCTTGGCGCTGCATGGCCTGCAACGCCCTCAACGACGACGACGATGATGATGATGATGATGATGGC
CATGATGACGGCCATGATGACGGCCATGACCTCGTCCCCACCGTCCATCCGCCGAGACACTCTTCACTCTCTCCT
CCTTCCCCCCCCCCTCCTCCCGACCACCAACAAGATGATGCCGACGACGCCCATGATCCATTCAGGCCAGATGGC
CCCGGCTGA
Gene >Ophio5|7183
ATGGTGTCGTTTTGGCCCTGGAAGGTCGGTTGTCCCCCCTCCCCCCCTCTTCTCACTTTCTGCGAGGTCAAGATG
GGTAAGGAGGCTGACGAAATGAACTTCTTGGCCTCAATACAAATACAGGGCGACGTCTCCTCTCCCGCCTCGTTC
GAAAAGACGCTCTCGGCCCTCTCCGTTAAGATCGCCGACTCCCAGTCCCGGCTTGATCGAGGTCGCAACAGCGCT
CGCCGCACAAAAGCCCTCTGGACTCTGTATCTGTCTTTTGCCTACGTCGTCTACGCCATCGTCCTGTTACTCGTC
GTCGGTCATCGCAACCTAGGCGCATACGAATGGACCGGCATGGCAGGCGGGCCCGTCCTGTAGGCTTTTCCCCTC
CTTGTCATACCGTCTCTTCCCATGATCTTCCCATGGCTGAGTTTGCCCTGTCCCCCTCGGCCGAGGTGAGGGCAT
CATGTGTGGAATTCAGAATATACGGCACCCGCGCCCTCATTGCCGCCCTCTTTGGCTTTCACATCGACCGGCTCG
CAGACCGGCTAAGGGACCAGCTCGAGACGCGCGCAAAGACGATCCAAAAGCTCAAGGATGCCACCAAGTACGATT
CCACCATGGAGCTCATCGAAAAATACGGCGGACCCAATCGTTCTCGCAGCCGAACTGCCGACTCCGGTTCCGACT
CGGAAGCCAACCGCAAGAAGATGACAACAACAGCCGTCCCTAACCGAACCTCAATGCCTCCCCCCCCAACCGCCA
ACATCGCTCGCACCCAACACCAAGGTCCTCCCATCCGTCTCCCCGCCACGCCCCCTGCGCCGTCGAAACAACAAC
AACAACAACAACAACCAGCAGCAGCAGCAGCAGCAGCAGCAGCACCGCAGCAACCCTCCTCCTCCCCGGACGTCG
TCGCCTCCGACACCGCCGACTTCGCGCCCAACGCCTTCAGCAGCCACGCCTCGTACGCCCACCCGGACTCGCGCC
ACTGGTACGATCGCATCTTGGACGTCCTCCTCGGCGAGGACGAAGCGGCGCCCAAGAACCGCATCGTCCTCATCT
GTCGCGCCTGTCGTCTGGTCAACGGCCAGGCCCCCCCCGGTACAAAGTCCCTCGTCGAGCTCGGCTCTTGGCGCT
GCATGGCCTGCAACGCCCTCAACGACGACGACGATGATGATGATGATGATGATGGCCATGATGACGGCCATGATG
ACGGCCATGACCTCGTCCCCACCGTCCATCCGCCGAGACACTCTTCACTCTCTCCTCCTTCCCCCCCCCCTCCTC
CCGACCACCAACAAGATGATGCCGACGACGCCCATGATCCATTCAGGCCAGATGGCCCCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail