Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7176
Gene name
Locationscaffold_674:7534..8483
Strand+
Gene length (bp)949
Transcript length (bp)672
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 3.4E-34 4 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54I60|PUR3_DICDI Phosphoribosylglycinamide formyltransferase OS=Dictyostelium discoideum GN=purN PE=3 SV=1 1 214 1.0E-45
sp|Q9UUK7|PUR3_SCHPO Phosphoribosylglycinamide formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade5 PE=2 SV=1 1 207 9.0E-43
sp|P04161|PUR3_YEAST Phosphoribosylglycinamide formyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE8 PE=1 SV=1 5 208 2.0E-31
sp|P43846|PUR3_HAEIN Phosphoribosylglycinamide formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purN PE=3 SV=1 5 203 3.0E-17
sp|Q5HH12|PUR3_STAAC Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain COL) GN=purN PE=3 SV=1 5 203 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54I60|PUR3_DICDI Phosphoribosylglycinamide formyltransferase OS=Dictyostelium discoideum GN=purN PE=3 SV=1 1 214 1.0E-45
sp|Q9UUK7|PUR3_SCHPO Phosphoribosylglycinamide formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade5 PE=2 SV=1 1 207 9.0E-43
sp|P04161|PUR3_YEAST Phosphoribosylglycinamide formyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE8 PE=1 SV=1 5 208 2.0E-31
sp|P43846|PUR3_HAEIN Phosphoribosylglycinamide formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purN PE=3 SV=1 5 203 3.0E-17
sp|Q5HH12|PUR3_STAAC Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain COL) GN=purN PE=3 SV=1 5 203 4.0E-17
sp|Q6GI12|PUR3_STAAR Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purN PE=3 SV=1 5 203 4.0E-17
sp|Q8NX89|PUR3_STAAW Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MW2) GN=purN PE=3 SV=1 5 203 5.0E-17
sp|Q6GAE1|PUR3_STAAS Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purN PE=3 SV=1 5 203 5.0E-17
sp|P99162|PUR3_STAAN Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain N315) GN=purN PE=1 SV=1 5 203 5.0E-17
sp|P65897|PUR3_STAAM Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purN PE=3 SV=1 5 203 5.0E-17
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 5 215 9.0E-17
sp|Q64737|PUR2_MOUSE Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus GN=Gart PE=1 SV=3 5 222 3.0E-16
sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens GN=GART PE=1 SV=1 5 216 4.0E-16
sp|P08179|PUR3_ECOLI Phosphoribosylglycinamide formyltransferase OS=Escherichia coli (strain K12) GN=purN PE=1 SV=1 4 203 3.0E-15
sp|Q59A32|PUR2_BOVIN Trifunctional purine biosynthetic protein adenosine-3 OS=Bos taurus GN=GART PE=2 SV=1 5 216 4.0E-15
sp|P12040|PUR3_BACSU Phosphoribosylglycinamide formyltransferase OS=Bacillus subtilis (strain 168) GN=purN PE=3 SV=2 7 202 1.0E-14
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 5 201 6.0E-14
sp|Q8CT28|PUR3_STAES Phosphoribosylglycinamide formyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purN PE=3 SV=1 3 203 6.0E-13
sp|Q5HQ98|PUR3_STAEQ Phosphoribosylglycinamide formyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purN PE=3 SV=1 3 203 6.0E-13
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 7 216 1.0E-11
sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 5 216 2.0E-11
sp|P52422|PUR3_ARATH Phosphoribosylglycinamide formyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PUR3 PE=2 SV=2 4 222 4.0E-10
sp|P52423|PUR3_VIGUN Phosphoribosylglycinamide formyltransferase, chloroplastic OS=Vigna unguiculata GN=PUR3 PE=2 SV=2 4 222 6.0E-08
sp|P9WHM5|PUR3_MYCTU Phosphoribosylglycinamide formyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purN PE=1 SV=1 5 200 2.0E-07
sp|P9WHM4|PUR3_MYCTO Phosphoribosylglycinamide formyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purN PE=3 SV=1 5 200 2.0E-07
sp|B9KBC2|FMT_THENN Methionyl-tRNA formyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fmt PE=3 SV=1 73 206 4.0E-07
sp|B2S3Z5|FMT_TREPS Methionyl-tRNA formyltransferase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=fmt PE=3 SV=1 32 204 2.0E-06
sp|O83737|FMT_TREPA Methionyl-tRNA formyltransferase OS=Treponema pallidum (strain Nichols) GN=fmt PE=3 SV=1 32 204 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7657 0.3976 0.1335 0.0167 0.2127 0.1933 0.0753 0.0801 0.2122 0.2619

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5650
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|952
Ophiocordyceps australis map64 (Brazil) OphauB2|3263
Ophiocordyceps camponoti-floridani Ophcf2|04037
Ophiocordyceps camponoti-rufipedis Ophun1|1596
Ophiocordyceps kimflemingae Ophio5|7176 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7176
MACNIVVLASGNGSNFEALCDGVADGRIPDAVISRLIVNRAAAGATARADRRSIPWEYFNLVAHGFLQKGERDPE
KVRRARDDYDAALARRILDIARPDLVVLAGWMHVFGASFLDPLAEAGVKVINLHPALPGQYDGAQAIERAYQDFL
AGRLERNRTGVMVHHVIQQVDRGEAILTREVECLRDDDLERLMGRMHAVEHELIVEATAIVAAEVVLSRRRGP
Coding >Ophio5|7176
ATGGCCTGCAACATCGTCGTCCTGGCCAGCGGCAACGGTTCCAACTTCGAAGCGCTGTGCGACGGCGTAGCAGAC
GGTCGCATACCGGACGCCGTTATCAGCCGGCTGATTGTCAATCGCGCGGCCGCGGGGGCAACGGCGCGTGCCGAC
CGCCGATCTATCCCGTGGGAATATTTTAACCTCGTCGCTCACGGCTTTCTACAGAAAGGCGAGCGCGATCCGGAG
AAAGTGCGTCGCGCGCGTGACGACTACGATGCCGCACTAGCTCGTCGAATTCTTGATATCGCGAGGCCCGACTTA
GTAGTGCTCGCTGGCTGGATGCACGTTTTTGGGGCTAGCTTCCTTGATCCTTTGGCCGAGGCGGGTGTCAAGGTG
ATCAACCTGCATCCGGCGTTGCCAGGCCAATACGACGGAGCTCAGGCCATTGAGCGGGCCTACCAAGATTTTCTA
GCCGGTCGGCTGGAGCGCAACCGGACGGGCGTCATGGTGCACCACGTTATCCAGCAGGTAGACCGTGGCGAGGCG
ATTCTTACGCGTGAGGTGGAATGCCTGCGCGATGACGACTTAGAGAGGCTGATGGGGCGGATGCATGCCGTCGAG
CATGAGCTGATTGTCGAGGCCACAGCTATAGTGGCGGCCGAGGTGGTGCTGTCCCGACGACGGGGACCC
Transcript >Ophio5|7176
ATGGCCTGCAACATCGTCGTCCTGGCCAGCGGCAACGGTTCCAACTTCGAAGCGCTGTGCGACGGCGTAGCAGAC
GGTCGCATACCGGACGCCGTTATCAGCCGGCTGATTGTCAATCGCGCGGCCGCGGGGGCAACGGCGCGTGCCGAC
CGCCGATCTATCCCGTGGGAATATTTTAACCTCGTCGCTCACGGCTTTCTACAGAAAGGCGAGCGCGATCCGGAG
AAAGTGCGTCGCGCGCGTGACGACTACGATGCCGCACTAGCTCGTCGAATTCTTGATATCGCGAGGCCCGACTTA
GTAGTGCTCGCTGGCTGGATGCACGTTTTTGGGGCTAGCTTCCTTGATCCTTTGGCCGAGGCGGGTGTCAAGGTG
ATCAACCTGCATCCGGCGTTGCCAGGCCAATACGACGGAGCTCAGGCCATTGAGCGGGCCTACCAAGATTTTCTA
GCCGGTCGGCTGGAGCGCAACCGGACGGGCGTCATGGTGCACCACGTTATCCAGCAGGTAGACCGTGGCGAGGCG
ATTCTTACGCGTGAGGTGGAATGCCTGCGCGATGACGACTTAGAGAGGCTGATGGGGCGGATGCATGCCGTCGAG
CATGAGCTGATTGTCGAGGCCACAGCTATAGTGGCGGCCGAGGTGGTGCTGTCCCGACGACGGGGACCCTGA
Gene >Ophio5|7176
ATGGCCTGCAACATCGTCGTCCTGGCCAGCGGCAACGGTTCCAACTTCGAAGCGCTGTGCGACGGCGTAGCAGAC
GGTCGCATACCGGACGCCGTTATCAGCCGGCTGATTGTCAATCGCGCGGCCGCGGGGGCAACGGCGCGTGCCGAC
CGCCGATCTATCCCGTGGGAATATTTTAACCTCGTCGCTCACGGCTTTCTACAGAAAGGCGAGCGCGATCCGGAG
AAAGTGCGTCGCGCGCGTGACGACTACGATGCCGCACTAGCTCGTCGAATTCTTGATATCGCGAGGCCCGACTTA
GTAGTGCTCGCTGGCTGGATGCACGTTTTTGGGGCTAGCTTCCTTGATCCTTTGGCCGAGGCGGGTGTCAAGGTG
ATCAACCTGCATCCGGCGTTGCCAGGTTGGTGGTTTTTCCCCAGCTATTGAGGGAGAGTGGGATTATCTTTCCAT
TTCTATTTTCATCAGCGGGCGTTTTTGGGGTTTTTTTTTTTTTTTTGCGGACCGTCCCTCTTGTCGGATTCTCGG
ACACTTTGTCCGTCCGTGTTCCGTGTTTCGCTTTCGGCCGTTCCTCATTGTGTTCGCTTTCAGTCCTTTGTTCGG
ACAGAAGGAGACAGCGAGAGGGCATCTCAGATCAAAAAGAAAAAGTCTTCATCGGCTAACAAAGCTCCGCGTTCT
AGGCCAATACGACGGAGCTCAGGCCATTGAGCGGGCCTACCAAGATTTTCTAGCCGGTCGGCTGGAGCGCAACCG
GACGGGCGTCATGGTGCACCACGTTATCCAGCAGGTAGACCGTGGCGAGGCGATTCTTACGCGTGAGGTGGAATG
CCTGCGCGATGACGACTTAGAGAGGCTGATGGGGCGGATGCATGCCGTCGAGCATGAGCTGATTGTCGAGGCCAC
AGCTATAGTGGCGGCCGAGGTGGTGCTGTCCCGACGACGGGGACCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail