Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7168
Gene name
Locationscaffold_672:3394..4674
Strand-
Gene length (bp)1280
Transcript length (bp)1092
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01992 vATP-synt_AC39 ATP synthase (C/AC39) subunit 6.4E-106 13 358

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53659|VA0D_NEUCR V-type proton ATPase subunit d OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-6 PE=3 SV=1 1 363 0.0E+00
sp|O13753|VA0D_SCHPO V-type proton ATPase subunit d OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma6 PE=3 SV=1 1 363 7.0E-136
sp|P32366|VA0D_YEAST V-type proton ATPase subunit d OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA6 PE=1 SV=2 1 363 1.0E-133
sp|P54641|VA0D_DICDI V-type proton ATPase subunit d OS=Dictyostelium discoideum GN=vatD-1 PE=1 SV=2 3 363 2.0E-132
sp|Q9W4P5|VA0D1_DROME V-type proton ATPase subunit d 1 OS=Drosophila melanogaster GN=VhaAC39-1 PE=2 SV=1 3 363 8.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53659|VA0D_NEUCR V-type proton ATPase subunit d OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-6 PE=3 SV=1 1 363 0.0E+00
sp|O13753|VA0D_SCHPO V-type proton ATPase subunit d OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma6 PE=3 SV=1 1 363 7.0E-136
sp|P32366|VA0D_YEAST V-type proton ATPase subunit d OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA6 PE=1 SV=2 1 363 1.0E-133
sp|P54641|VA0D_DICDI V-type proton ATPase subunit d OS=Dictyostelium discoideum GN=vatD-1 PE=1 SV=2 3 363 2.0E-132
sp|Q9W4P5|VA0D1_DROME V-type proton ATPase subunit d 1 OS=Drosophila melanogaster GN=VhaAC39-1 PE=2 SV=1 3 363 8.0E-129
sp|Q6PGV1|VA0D1_DANRE V-type proton ATPase subunit d 1 OS=Danio rerio GN=atp6v0d1 PE=1 SV=1 4 363 1.0E-127
sp|Q5R6I1|VA0D1_PONAB V-type proton ATPase subunit d 1 OS=Pongo abelii GN=ATP6V0D1 PE=2 SV=1 4 363 1.0E-126
sp|P61421|VA0D1_HUMAN V-type proton ATPase subunit d 1 OS=Homo sapiens GN=ATP6V0D1 PE=1 SV=1 4 363 1.0E-126
sp|P61420|VA0D1_BOVIN V-type proton ATPase subunit d 1 OS=Bos taurus GN=ATP6V0D1 PE=1 SV=1 4 363 1.0E-126
sp|P51863|VA0D1_MOUSE V-type proton ATPase subunit d 1 OS=Mus musculus GN=Atp6v0d1 PE=1 SV=2 4 363 3.0E-126
sp|Q25531|VA0D_MANSE V-type proton ATPase subunit d OS=Manduca sexta PE=2 SV=1 1 363 4.0E-126
sp|Q5ZHL0|VA0D2_CHICK V-type proton ATPase subunit d 2 OS=Gallus gallus GN=ATP6V0D2 PE=2 SV=1 4 363 6.0E-125
sp|Q9LJI5|VA0D1_ARATH V-type proton ATPase subunit d1 OS=Arabidopsis thaliana GN=VHA-d1 PE=2 SV=1 2 360 1.0E-120
sp|Q6P335|VA0D2_XENTR V-type proton ATPase subunit d 2 OS=Xenopus tropicalis GN=atp6v0d2 PE=2 SV=1 4 362 2.0E-120
sp|Q8RU33|VA0D_ORYSJ Probable V-type proton ATPase subunit d OS=Oryza sativa subsp. japonica GN=Os01g0587000 PE=2 SV=1 2 360 5.0E-120
sp|Q9LHA4|VA0D2_ARATH V-type proton ATPase subunit d2 OS=Arabidopsis thaliana GN=VHA-d2 PE=2 SV=1 2 360 1.0E-119
sp|Q5FVL0|VA0D2_RAT V-type proton ATPase subunit d 2 OS=Rattus norvegicus GN=Atp6v0d2 PE=2 SV=1 4 363 3.0E-119
sp|Q8N8Y2|VA0D2_HUMAN V-type proton ATPase subunit d 2 OS=Homo sapiens GN=ATP6V0D2 PE=2 SV=1 4 363 1.0E-118
sp|Q80SY3|VA0D2_MOUSE V-type proton ATPase subunit d 2 OS=Mus musculus GN=Atp6v0d2 PE=2 SV=2 4 363 1.0E-117
sp|Q5R7B7|VA0D2_PONAB V-type proton ATPase subunit d 2 OS=Pongo abelii GN=ATP6V0D2 PE=2 SV=2 4 363 8.0E-117
sp|Q2KJB6|VA0D2_BOVIN V-type proton ATPase subunit d 2 OS=Bos taurus GN=ATP6V0D2 PE=2 SV=1 4 363 4.0E-114
sp|Q9VCQ3|VA0D2_DROME Probable V-type proton ATPase subunit d 2 OS=Drosophila melanogaster GN=VhaAC39-2 PE=2 SV=1 3 362 7.0E-79
[Show less]

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0015078 proton transmembrane transporter activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7168
MEGLFFNVNNGYVEGIVRGYRNSLLTGPAYNNLTQCETIDDLKLQLGPAYGDFLASLPPNPSTSSLASRTTDKLI
SEFRYVRANAVGSLATFMDYVTYGYMIDNVALLITGTLHERDTRELLERCHPLGWFEAMPVLCVATNIEELYNSV
LIETPLAPYFKGSLSHQDLDELNIEIVRNTLYKNYLEDFHRFVNTEPGMVGTPTAEVMSEILEFEADRRAINITL
NSFGTELSKADRRRLYPALGKLYPEGTLMLSRADDVEGVRLAVDGVHDYKTFFDAVSLGGSLGAGNMGGGSTDGR
TLEDMFYQKEMEISKSAFTRQFTYAIIYAWVKLREQEIRNITWIAECIAQNQKDRIGNFISVF
Coding >Ophio5|7168
ATGGAGGGCCTTTTCTTCAATGTCAACAACGGATATGTTGAGGGCATCGTCCGAGGTTACCGGAACAGCCTGCTC
ACGGGCCCCGCCTACAACAATCTGACGCAATGCGAGACGATTGACGATCTCAAGCTGCAGCTGGGTCCCGCCTAC
GGCGACTTCCTTGCTTCCCTACCCCCAAACCCATCGACCTCCAGCCTCGCCTCGAGGACTACCGATAAGCTCATC
TCAGAGTTCCGCTACGTCCGCGCAAACGCCGTGGGGTCACTAGCGACCTTTATGGACTACGTCACGTATGGCTAC
ATGATCGACAACGTGGCCCTGCTCATCACAGGCACCCTGCACGAAAGAGACACTCGCGAGCTGCTGGAGCGCTGC
CACCCTCTCGGCTGGTTCGAGGCGATGCCTGTGCTCTGCGTCGCGACCAATATCGAGGAGCTATACAACAGCGTC
CTCATCGAAACGCCCCTGGCCCCCTACTTCAAGGGTAGCCTCAGTCACCAAGACCTCGACGAGCTCAACATTGAG
ATTGTGCGCAACACGCTGTACAAGAACTATCTCGAAGACTTCCACCGTTTCGTCAACACCGAGCCCGGAATGGTC
GGCACGCCGACAGCCGAGGTCATGTCGGAGATTCTCGAGTTTGAGGCCGACCGTCGCGCCATTAATATCACCCTG
AACTCGTTTGGAACAGAGCTGAGCAAGGCAGACCGTAGGAGGCTGTACCCTGCCTTGGGCAAGCTGTATCCTGAG
GGAACCCTGATGCTCTCGCGGGCAGACGACGTCGAAGGTGTGCGTCTCGCCGTCGACGGCGTTCACGACTACAAG
ACCTTCTTCGACGCCGTCTCTCTCGGCGGATCCCTGGGCGCCGGCAACATGGGCGGCGGGTCCACCGACGGTAGG
ACGCTCGAAGACATGTTCTACCAGAAAGAAATGGAAATATCCAAGAGCGCCTTTACGCGGCAGTTTACCTACGCC
ATCATCTACGCCTGGGTCAAGTTGAGGGAGCAGGAGATCCGTAACATCACCTGGATTGCCGAATGCATAGCCCAG
AACCAGAAAGATCGCATCGGAAACTTTATCAGCGTCTTC
Transcript >Ophio5|7168
ATGGAGGGCCTTTTCTTCAATGTCAACAACGGATATGTTGAGGGCATCGTCCGAGGTTACCGGAACAGCCTGCTC
ACGGGCCCCGCCTACAACAATCTGACGCAATGCGAGACGATTGACGATCTCAAGCTGCAGCTGGGTCCCGCCTAC
GGCGACTTCCTTGCTTCCCTACCCCCAAACCCATCGACCTCCAGCCTCGCCTCGAGGACTACCGATAAGCTCATC
TCAGAGTTCCGCTACGTCCGCGCAAACGCCGTGGGGTCACTAGCGACCTTTATGGACTACGTCACGTATGGCTAC
ATGATCGACAACGTGGCCCTGCTCATCACAGGCACCCTGCACGAAAGAGACACTCGCGAGCTGCTGGAGCGCTGC
CACCCTCTCGGCTGGTTCGAGGCGATGCCTGTGCTCTGCGTCGCGACCAATATCGAGGAGCTATACAACAGCGTC
CTCATCGAAACGCCCCTGGCCCCCTACTTCAAGGGTAGCCTCAGTCACCAAGACCTCGACGAGCTCAACATTGAG
ATTGTGCGCAACACGCTGTACAAGAACTATCTCGAAGACTTCCACCGTTTCGTCAACACCGAGCCCGGAATGGTC
GGCACGCCGACAGCCGAGGTCATGTCGGAGATTCTCGAGTTTGAGGCCGACCGTCGCGCCATTAATATCACCCTG
AACTCGTTTGGAACAGAGCTGAGCAAGGCAGACCGTAGGAGGCTGTACCCTGCCTTGGGCAAGCTGTATCCTGAG
GGAACCCTGATGCTCTCGCGGGCAGACGACGTCGAAGGTGTGCGTCTCGCCGTCGACGGCGTTCACGACTACAAG
ACCTTCTTCGACGCCGTCTCTCTCGGCGGATCCCTGGGCGCCGGCAACATGGGCGGCGGGTCCACCGACGGTAGG
ACGCTCGAAGACATGTTCTACCAGAAAGAAATGGAAATATCCAAGAGCGCCTTTACGCGGCAGTTTACCTACGCC
ATCATCTACGCCTGGGTCAAGTTGAGGGAGCAGGAGATCCGTAACATCACCTGGATTGCCGAATGCATAGCCCAG
AACCAGAAAGATCGCATCGGAAACTTTATCAGCGTCTTCTGA
Gene >Ophio5|7168
ATGGAGGGCCTTTTCTTCAATGTCAACAACGGGTCGGTGTCGCCCTGCTTGCTACCATACCGCCGCCTGCGATCC
ATGCTGACTCCCGCAGATATGTTGAGGGCATCGTCCGAGGTTACCGGAACAGCCTGCTCACGGGCCCCGCCTACA
ACAATCTGACGCAATGCGAGACGATTGACGGTATGCTTTCCCGGGGTCGATGCTACGATTTATGTTCTCAGCCCT
GTTTCCCGCGGCCTCGTACTGAGTCAACGACACAGATCTCAAGCTGCAGCTGGGTCCCGCCTACGGCGACTTCCT
TGCTTCCCTACCCCCAAACCCATCGACCTCCAGCCTCGCCTCGAGGACTACCGATAAGCTCATCTCAGAGTTCCG
CTACGTCCGCGCAAACGCCGTGGGGTCACTAGCGACCTTTATGGACTACGTCACGTATGGCTACATGATCGACAA
CGTGGCCCTGCTCATCACAGGCACCCTGCACGAAAGAGACACTCGCGAGCTGCTGGAGCGCTGCCACCCTCTCGG
CTGGTTCGAGGCGATGCCTGTGCTCTGCGTCGCGACCAATATCGAGGAGCTATACAACAGCGTCCTCATCGAAAC
GCCCCTGGCCCCCTACTTCAAGGGTAGCCTCAGTCACCAAGACCTCGACGAGCTCAACATTGAGATTGTGCGCAA
CACGCTGTACAAGAACTATCTCGAAGACTTCCACCGTTTCGTCAACACCGAGCCCGGAATGGTCGGCACGCCGAC
AGCCGAGGTCATGTCGGAGATTCTCGAGTTTGAGGCCGACCGTCGCGCCATTAATATCACCCTGAACTCGTTTGG
AACAGAGCTGAGCAAGGCAGACCGTAGGAGGCTGTACCCTGCCTTGGGCAAGCTGTATCCTGAGGGAACCCTGAT
GCTCTCGCGGGCAGACGACGTCGAAGGTGTGCGTCTCGCCGTCGACGGCGTTCACGACTACAAGACCTTCTTCGA
CGCCGTCTCTCTCGGCGGATCCCTGGGCGCCGGCAACATGGGCGGCGGGTCCACCGACGGTAGGACGCTCGAAGA
CATGTTCTACCAGAAAGAAATGGAAATATCCAAGAGCGCCTTTACGCGGCAGTTTACCTACGCCATCATCTACGC
CTGGGTCAAGTTGAGGGAGCAGGTACGTGACTCCGGGCAGAACGGCTAGGCGCGGCACTAATGGCGAGCAGGAGA
TCCGTAACATCACCTGGATTGCCGAATGCATAGCCCAGAACCAGAAAGATCGCATCGGAAACTTTATCAGCGTCT
TCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail