Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7165
Gene name
Locationscaffold_671:9083..9596
Strand+
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 1.4E-15 23 140

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.44 0.0 1.44
CcL In ants, during behavior modification 19.23 3.2 35.25
CcD In ants, recently dead 1.62 0.0 3.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.118989 no
SC16a CcD 0.228563 no
CcL CcD 0.001851 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7165
MHFLSTSTLALLALANTALGAGAVHSSMSKINNDMLATDRSVSSWAGNLLTVAPVLMRANSLMGSLKAGTDATKN
AGNLTADEAKNVLDMVTESGNSARQLSDTLVGAKSKFSQIPLADVFVAGLMDAFAKRTQEFGAALNDKMPEAKER
VSAAFESVQDSIGDAAKAYA
Coding >Ophio5|7165
ATGCACTTCCTCTCCACCAGCACCCTTGCCCTCTTGGCACTGGCAAACACCGCTCTCGGCGCGGGAGCCGTCCAC
TCGAGCATGAGCAAGATCAACAACGACATGCTCGCCACCGACCGCAGCGTCAGCAGCTGGGCCGGCAACCTACTT
ACCGTAGCCCCCGTCCTGATGAGGGCCAACAGTCTGATGGGAAGCCTCAAGGCCGGCACGGATGCGACCAAGAAC
GCCGGGAACCTGACGGCTGACGAGGCCAAAAATGTTTTGGATATGGTCACGGAATCCGGCAACAGCGCTCGCCAG
CTCTCCGACACTCTCGTCGGTGCCAAATCCAAATTCAGCCAGATTCCGCTTGCGGATGTCTTCGTTGCCGGTCTC
ATGGATGCCTTCGCTAAGAGGACTCAAGAGTTTGGAGCCGCGCTCAACGACAAGATGCCCGAGGCCAAGGAGCGC
GTTTCCGCTGCCTTTGAGAGTGTTCAAGATAGCATCGGAGATGCGGCCAAGGCCTACGCC
Transcript >Ophio5|7165
ATGCACTTCCTCTCCACCAGCACCCTTGCCCTCTTGGCACTGGCAAACACCGCTCTCGGCGCGGGAGCCGTCCAC
TCGAGCATGAGCAAGATCAACAACGACATGCTCGCCACCGACCGCAGCGTCAGCAGCTGGGCCGGCAACCTACTT
ACCGTAGCCCCCGTCCTGATGAGGGCCAACAGTCTGATGGGAAGCCTCAAGGCCGGCACGGATGCGACCAAGAAC
GCCGGGAACCTGACGGCTGACGAGGCCAAAAATGTTTTGGATATGGTCACGGAATCCGGCAACAGCGCTCGCCAG
CTCTCCGACACTCTCGTCGGTGCCAAATCCAAATTCAGCCAGATTCCGCTTGCGGATGTCTTCGTTGCCGGTCTC
ATGGATGCCTTCGCTAAGAGGACTCAAGAGTTTGGAGCCGCGCTCAACGACAAGATGCCCGAGGCCAAGGAGCGC
GTTTCCGCTGCCTTTGAGAGTGTTCAAGATAGCATCGGAGATGCGGCCAAGGCCTACGCCTGA
Gene >Ophio5|7165
ATGCACTTCCTCTCCACCAGCACCCTTGCCCTCTTGGCACTGGCAAACACCGCTCTCGGCGCGGGAGCCGTCCAC
TCGAGCATGAGCAAGATCAACAACGACATGCTCGCCACCGACCGCAGCGTCAGCAGCTGGGCCGGCAACCTACTT
ACCGTAGCCCCCGTCCTGATGAGGGCCAACAGTCTGATGGGAAGCCTCAAGGCCGGCACGGATGCGACCAAGAAC
GCCGGGAACCTGACGGCTGACGAGGCCAAAAATGTTTTGGATATGGTCACGGAATCCGGCAACAGCGCTCGCCAG
CTCTCCGACACTCTCGTCGGTGCCAAATCCAAATTCAGCCAGATTCCGCTTGCGGATGTCTTCGTTGCCGGTCTC
ATGGATGCCTTCGCTAAGAGGACTCAAGAGTTTGGAGCCGCGCTCAACGACAAGATGCCCGAGGCCAAGGAGCGC
GTTTCCGCTGCCTTTGAGAGTGTTCAAGATAGCATCGGAGATGCGGCCAAGGCCTACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail