Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7153
Gene name
Locationscaffold_67:41680..42318
Strand+
Gene length (bp)638
Transcript length (bp)519
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00717 Peptidase_S24 Peptidase S24-like 4.3E-05 27 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9E796|SEC11_METAQ Signal peptidase complex catalytic subunit SEC11 OS=Metarhizium acridum (strain CQMa 102) GN=SEC11 PE=3 SV=1 1 172 2.0E-111
sp|E9F8V9|SEC11_METRA Signal peptidase complex catalytic subunit SEC11 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=SEC11 PE=3 SV=1 1 172 9.0E-111
sp|C7ZHK5|SEC11_NECH7 Signal peptidase complex catalytic subunit SEC11 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=SEC11 PE=3 SV=1 1 172 5.0E-109
sp|C9S8G0|SEC11_VERA1 Signal peptidase complex catalytic subunit SEC11 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=SEC11 PE=3 SV=1 1 172 8.0E-109
sp|A7E716|SEC11_SCLS1 Signal peptidase complex catalytic subunit sec11 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sec11 PE=3 SV=1 1 172 1.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9E796|SEC11_METAQ Signal peptidase complex catalytic subunit SEC11 OS=Metarhizium acridum (strain CQMa 102) GN=SEC11 PE=3 SV=1 1 172 2.0E-111
sp|E9F8V9|SEC11_METRA Signal peptidase complex catalytic subunit SEC11 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=SEC11 PE=3 SV=1 1 172 9.0E-111
sp|C7ZHK5|SEC11_NECH7 Signal peptidase complex catalytic subunit SEC11 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=SEC11 PE=3 SV=1 1 172 5.0E-109
sp|C9S8G0|SEC11_VERA1 Signal peptidase complex catalytic subunit SEC11 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=SEC11 PE=3 SV=1 1 172 8.0E-109
sp|A7E716|SEC11_SCLS1 Signal peptidase complex catalytic subunit sec11 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sec11 PE=3 SV=1 1 172 1.0E-108
sp|A4RGA1|SEC11_MAGO7 Signal peptidase complex catalytic subunit SEC11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC11 PE=3 SV=1 1 172 7.0E-108
sp|Q2H1P3|SEC11_CHAGB Signal peptidase complex catalytic subunit SEC11 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC11 PE=3 SV=1 1 172 3.0E-107
sp|Q7RY44|SEC11_NEUCR Signal peptidase complex catalytic subunit sec11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec11 PE=3 SV=1 1 172 1.0E-104
sp|F0XJH4|SEC11_GROCL Signal peptidase complex catalytic subunit SEC11 OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=SEC11 PE=3 SV=1 1 172 2.0E-100
sp|E3QXY4|SEC11_COLGM Signal peptidase complex catalytic subunit SEC11 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=SEC11 PE=3 SV=1 1 172 1.0E-98
sp|B2B3T2|SEC11_PODAN Signal peptidase complex catalytic subunit SEC11 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SEC11 PE=3 SV=1 1 172 5.0E-92
sp|B2WEL2|SEC11_PYRTR Signal peptidase complex catalytic subunit sec11 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sec11 PE=3 SV=1 7 172 2.0E-88
sp|E3RR70|SEC11_PYRTT Signal peptidase complex catalytic subunit sec11 OS=Pyrenophora teres f. teres (strain 0-1) GN=sec11 PE=3 SV=1 7 172 4.0E-88
sp|E5A8D2|SEC11_LEPMJ Signal peptidase complex catalytic subunit SEC11 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=SEC11 PE=3 SV=1 7 172 7.0E-87
sp|D5GNC3|SEC11_TUBMM Signal peptidase complex catalytic subunit SEC11 OS=Tuber melanosporum (strain Mel28) GN=SEC11 PE=3 SV=1 7 172 1.0E-84
sp|C5G8L5|SEC11_AJEDR Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SEC11 PE=3 SV=1 3 172 1.0E-82
sp|B6Q5G0|SEC11_TALMQ Signal peptidase complex catalytic subunit sec11 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sec11 PE=3 SV=1 5 172 2.0E-82
sp|Q5B8K4|SEC11_EMENI Signal peptidase complex catalytic subunit sec11 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec11 PE=3 SV=2 5 172 3.0E-82
sp|C5JJG5|SEC11_AJEDS Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SEC11 PE=3 SV=1 5 172 7.0E-82
sp|B6HC89|SEC11_PENRW Signal peptidase complex catalytic subunit sec11 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sec11 PE=3 SV=1 4 172 9.0E-82
sp|C5FQ45|SEC11_ARTOC Signal peptidase complex catalytic subunit SEC11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SEC11 PE=3 SV=1 1 172 5.0E-81
sp|C4JYM4|SEC11_UNCRE Signal peptidase complex catalytic subunit SEC11 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SEC11 PE=3 SV=1 3 172 6.0E-81
sp|E9CXH2|SEC11_COCPS Signal peptidase complex catalytic subunit SEC11 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=SEC11 PE=3 SV=1 3 172 8.0E-81
sp|D4ALL0|SEC11_ARTBC Signal peptidase complex catalytic subunit SEC11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SEC11 PE=3 SV=1 1 172 8.0E-81
sp|D4D5I1|SEC11_TRIVH Signal peptidase complex catalytic subunit SEC11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SEC11 PE=3 SV=1 1 172 8.0E-81
sp|E4V4X0|SEC11_ARTGP Signal peptidase complex catalytic subunit SEC11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SEC11 PE=3 SV=1 1 172 2.0E-80
sp|C5PA33|SEC11_COCP7 Signal peptidase complex catalytic subunit SEC11 OS=Coccidioides posadasii (strain C735) GN=SEC11 PE=3 SV=1 3 172 2.0E-80
sp|C0S3S0|SEC11_PARBP Signal peptidase complex catalytic subunit SEC11 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SEC11 PE=3 SV=2 1 172 2.0E-80
sp|C1FYD2|SEC11_PARBD Signal peptidase complex catalytic subunit SEC11 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SEC11 PE=3 SV=1 1 172 2.0E-80
sp|C1GU90|SEC11_PARBA Signal peptidase complex catalytic subunit SEC11 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SEC11 PE=3 SV=1 1 172 3.0E-80
sp|B8M5K5|SEC11_TALSN Signal peptidase complex catalytic subunit sec11 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sec11 PE=3 SV=1 5 172 4.0E-80
sp|B0XWT3|SEC11_ASPFC Signal peptidase complex catalytic subunit sec11 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sec11 PE=3 SV=1 9 172 1.0E-79
sp|Q4WYF4|SEC11_ASPFU Signal peptidase complex catalytic subunit sec11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec11 PE=3 SV=1 9 172 1.0E-79
sp|A1CL29|SEC11_ASPCL Signal peptidase complex catalytic subunit sec11 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec11 PE=3 SV=1 9 172 1.0E-79
sp|A1D6D8|SEC11_NEOFI Signal peptidase complex catalytic subunit sec11 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec11 PE=3 SV=1 9 172 2.0E-79
sp|Q0CQC5|SEC11_ASPTN Signal peptidase complex catalytic subunit sec11 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec11 PE=3 SV=1 5 172 9.0E-79
sp|A6QX24|SEC11_AJECN Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SEC11 PE=3 SV=1 3 172 2.0E-76
sp|C0NKT8|SEC11_AJECG Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SEC11 PE=3 SV=1 3 172 3.0E-76
sp|C6HB29|SEC11_AJECH Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces capsulatus (strain H143) GN=SEC11 PE=3 SV=1 3 172 2.0E-75
sp|F0UDD2|SEC11_AJEC8 Signal peptidase complex catalytic subunit SEC11 OS=Ajellomyces capsulatus (strain H88) GN=SEC11 PE=3 SV=1 3 172 2.0E-75
sp|Q2UBW3|SEC11_ASPOR Signal peptidase complex catalytic subunit sec11 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec11 PE=3 SV=1 4 172 3.0E-71
sp|C5M4J6|SEC11_CANTT Signal peptidase complex catalytic subunit SEC11 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SEC11 PE=3 SV=1 7 172 6.0E-61
sp|Q6BP15|SEC11_DEBHA Signal peptidase complex catalytic subunit SEC11 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC11 PE=3 SV=2 7 172 3.0E-60
sp|C4QXP7|SEC11_PICPG Signal peptidase complex catalytic subunit SEC11 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC11 PE=3 SV=1 7 172 6.0E-59
sp|C4Y3D4|SEC11_CLAL4 Signal peptidase complex catalytic subunit SEC11 OS=Clavispora lusitaniae (strain ATCC 42720) GN=SEC11 PE=3 SV=1 7 172 6.0E-59
sp|A5DIZ8|SEC11_PICGU Signal peptidase complex catalytic subunit SEC11 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC11 PE=3 SV=3 7 172 2.0E-58
sp|C5E3W1|SEC11_ZYGRC Signal peptidase complex catalytic subunit SEC11 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SEC11 PE=3 SV=1 7 172 1.0E-57
sp|Q6CAG9|SEC11_YARLI Signal peptidase complex catalytic subunit SEC11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC11 PE=3 SV=1 4 172 2.0E-57
sp|A3LXS1|SEC11_PICST Signal sequence processing protein OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC11 PE=3 SV=1 7 172 2.0E-57
sp|C4YNJ0|SEC11_CANAW Signal peptidase complex catalytic subunit SEC11 OS=Candida albicans (strain WO-1) GN=SEC11 PE=3 SV=1 7 159 3.0E-57
sp|Q5A869|SEC11_CANAL Signal peptidase complex catalytic subunit SEC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC11 PE=3 SV=1 7 159 3.0E-57
sp|B9WKT4|SEC11_CANDC Signal peptidase complex catalytic subunit SEC11 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SEC11 PE=3 SV=1 7 159 8.0E-57
sp|Q759W4|SEC11_ASHGO Signal peptidase complex catalytic subunit SEC11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC11 PE=3 SV=1 7 172 4.0E-56
sp|A5DS09|SEC11_LODEL Signal peptidase complex catalytic subunit SEC11 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC11 PE=3 SV=2 7 156 5.0E-56
sp|B3LTI7|SEC11_YEAS1 Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|C7GLT4|SEC11_YEAS2 Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain JAY291) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|A6ZVU2|SEC11_YEAS7 Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain YJM789) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|C8ZAS4|SEC11_YEAS8 Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|E7KDY6|SEC11_YEASA Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain AWRI796) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|E7KQ01|SEC11_YEASL Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|P15367|SEC11_YEAST Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC11 PE=1 SV=2 7 172 8.0E-55
sp|E7LVX4|SEC11_YEASV Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain VIN 13) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|E7QG89|SEC11_YEASZ Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|E7Q587|SEC11_YEASB Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain FostersB) GN=SEC11 PE=3 SV=1 7 172 8.0E-55
sp|C5DDH1|SEC11_LACTC Signal peptidase complex catalytic subunit SEC11 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=SEC11 PE=3 SV=1 7 172 1.0E-54
sp|Q9D8V7|SC11C_MOUSE Signal peptidase complex catalytic subunit SEC11C OS=Mus musculus GN=Sec11c PE=1 SV=3 7 172 5.0E-53
sp|Q5RC30|SC11C_PONAB Signal peptidase complex catalytic subunit SEC11C OS=Pongo abelii GN=SEC11C PE=2 SV=3 7 172 5.0E-53
sp|Q9BY50|SC11C_HUMAN Signal peptidase complex catalytic subunit SEC11C OS=Homo sapiens GN=SEC11C PE=1 SV=3 7 172 5.0E-53
sp|P13679|SC11C_CANLF Signal peptidase complex catalytic subunit SEC11C OS=Canis lupus familiaris GN=SEC11C PE=1 SV=3 7 172 5.0E-53
sp|Q9WTR7|SC11C_RAT Signal peptidase complex catalytic subunit SEC11C OS=Rattus norvegicus GN=Sec11c PE=2 SV=3 7 172 1.0E-52
sp|E7R7C4|SEC11_OGAPD Signal peptidase complex catalytic subunit SEC11 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=SEC11 PE=3 SV=1 7 172 3.0E-50
sp|D8Q7Q5|SEC11_SCHCM Signal peptidase complex catalytic subunit SEC11 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SEC11 PE=3 SV=1 9 172 6.0E-50
sp|Q6CMR5|SEC11_KLULA Signal peptidase complex catalytic subunit SEC11 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC11 PE=3 SV=1 7 156 7.0E-50
sp|Q9R0P6|SC11A_MOUSE Signal peptidase complex catalytic subunit SEC11A OS=Mus musculus GN=Sec11a PE=1 SV=1 7 156 6.0E-49
sp|Q5R9C7|SC11A_PONAB Signal peptidase complex catalytic subunit SEC11A OS=Pongo abelii GN=SEC11A PE=2 SV=1 7 156 9.0E-49
sp|P67812|SC11A_HUMAN Signal peptidase complex catalytic subunit SEC11A OS=Homo sapiens GN=SEC11A PE=1 SV=1 7 156 9.0E-49
sp|P67811|SC11A_CANLF Signal peptidase complex catalytic subunit SEC11A OS=Canis lupus familiaris GN=SEC11A PE=1 SV=1 7 156 9.0E-49
sp|P67810|SC11A_BOVIN Signal peptidase complex catalytic subunit SEC11A OS=Bos taurus GN=SEC11A PE=2 SV=1 7 156 9.0E-49
sp|P42667|SC11A_RAT Signal peptidase complex catalytic subunit SEC11A OS=Rattus norvegicus GN=Sec11a PE=2 SV=1 7 153 4.0E-48
sp|O74323|SEC11_SCHPO Signal peptidase complex catalytic subunit sec11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec11 PE=3 SV=1 9 172 2.0E-45
sp|B0D4L0|SEC11_LACBS Signal peptidase complex catalytic subunit SEC11 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=SEC11 PE=3 SV=1 9 172 4.0E-43
sp|Q86JD4|SEC11_DICDI Signal peptidase complex catalytic subunit sec11 OS=Dictyostelium discoideum GN=sec11 PE=3 SV=1 9 172 4.0E-40
sp|P0C7V7|SC11B_HUMAN Putative signal peptidase complex catalytic subunit SEC11B OS=Homo sapiens GN=SEC11B PE=5 SV=1 14 156 9.0E-38
sp|P54506|LEPW_BACSU Signal peptidase I W OS=Bacillus subtilis (strain 168) GN=sipW PE=1 SV=1 45 169 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 131 150 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7153
MLPGLHNPRQAAAQLMNFALILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLLLLWNRNILKETGVGE
VVVYNVKDKDIPIVHRVVRKFGSGEKAKLLTKGDNNVADDTDLYARGQDYLERKDIIGSVVGYVPFVGYVTIMLS
EHPWMKTVMLGLMGLLVVLQRE
Coding >Ophio5|7153
ATGCTGCCCGGCCTCCACAACCCCCGCCAGGCGGCGGCCCAGCTTATGAACTTTGCCCTCATCCTCTCCACAGCC
TTCATGATGTGGAAGGGCCTCTCTGTGGCTACCGACTCGCCGTCCCCCATCGTCGTCGTCCTCTCCGGCTCCATG
GAGCCTGCCTTCCAGCGAGGCGACCTGCTACTGTTATGGAACCGAAACATATTGAAAGAGACGGGTGTCGGCGAG
GTTGTCGTATACAACGTCAAGGACAAGGACATTCCGATTGTTCACAGGGTCGTGCGCAAGTTCGGCTCCGGCGAA
AAGGCCAAGCTCCTCACAAAGGGCGACAACAACGTTGCCGACGACACCGATCTATACGCCCGCGGTCAGGACTAC
CTGGAGCGCAAAGACATCATCGGCAGCGTCGTCGGCTACGTGCCTTTTGTCGGCTACGTCACCATCATGCTGTCC
GAGCACCCTTGGATGAAGACGGTCATGTTGGGGCTCATGGGCTTGTTGGTTGTTCTGCAACGAGAG
Transcript >Ophio5|7153
ATGCTGCCCGGCCTCCACAACCCCCGCCAGGCGGCGGCCCAGCTTATGAACTTTGCCCTCATCCTCTCCACAGCC
TTCATGATGTGGAAGGGCCTCTCTGTGGCTACCGACTCGCCGTCCCCCATCGTCGTCGTCCTCTCCGGCTCCATG
GAGCCTGCCTTCCAGCGAGGCGACCTGCTACTGTTATGGAACCGAAACATATTGAAAGAGACGGGTGTCGGCGAG
GTTGTCGTATACAACGTCAAGGACAAGGACATTCCGATTGTTCACAGGGTCGTGCGCAAGTTCGGCTCCGGCGAA
AAGGCCAAGCTCCTCACAAAGGGCGACAACAACGTTGCCGACGACACCGATCTATACGCCCGCGGTCAGGACTAC
CTGGAGCGCAAAGACATCATCGGCAGCGTCGTCGGCTACGTGCCTTTTGTCGGCTACGTCACCATCATGCTGTCC
GAGCACCCTTGGATGAAGACGGTCATGTTGGGGCTCATGGGCTTGTTGGTTGTTCTGCAACGAGAGTGA
Gene >Ophio5|7153
ATGCTGCCCGGCCTCCACAACCCCCGCCAGGCGGCGGCCCAGCTTATGAACTTTGCCCTCATCCTCTCCACAGCC
TTCATGGTGTGTTACGCTTTTTTCCCCTTCCGTAGCACCGAATGCTCTCACACTCATCTCTTTGCAGATGTGGAA
GGGCCTCTCTGTGGCTACCGACTCGCCGTCCCCCATCGTCGTCGTCCTCTCCGGCTCCATGGAGCCTGCCTTCCA
GCGAGGCGACCTGCTACTGTTATGGAACCGAAACATATTGAAAGAGACGGGTGTCGGCGAGGTTGTCGTATACAA
CGTCAAGGACAAGGACATTCCGATTGTTCACAGGGTCGTGCGCAAGTTCGGCTCCGGGTAGGTTCTCCGTCACTT
GGGGCCTAAAACACTGGATATGAAGCTCACCTTTTGGCAGCGAAAAGGCCAAGCTCCTCACAAAGGGCGACAACA
ACGTTGCCGACGACACCGATCTATACGCCCGCGGTCAGGACTACCTGGAGCGCAAAGACATCATCGGCAGCGTCG
TCGGCTACGTGCCTTTTGTCGGCTACGTCACCATCATGCTGTCCGAGCACCCTTGGATGAAGACGGTCATGTTGG
GGCTCATGGGCTTGTTGGTTGTTCTGCAACGAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail