Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7147
Gene name
Locationscaffold_67:30335..31211
Strand+
Gene length (bp)876
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 5.3E-23 28 287
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 2.9E-12 30 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 26 287 3.0E-19
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 9 285 2.0E-16
sp|Q6B6R8|ESTA_PSEPU Esterase EstA OS=Pseudomonas putida GN=estA PE=3 SV=1 5 285 6.0E-10
sp|O33407|ESTA_PSEAE Esterase EstA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=estA PE=1 SV=1 5 285 6.0E-10
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 26 284 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 26 287 3.0E-19
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 9 285 2.0E-16
sp|Q6B6R8|ESTA_PSEPU Esterase EstA OS=Pseudomonas putida GN=estA PE=3 SV=1 5 285 6.0E-10
sp|O33407|ESTA_PSEAE Esterase EstA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=estA PE=1 SV=1 5 285 6.0E-10
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 26 284 2.0E-09
sp|O80470|GDL38_ARATH GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana GN=At2g23540 PE=2 SV=1 4 287 1.0E-08
sp|Q9SJB4|GDL34_ARATH GDSL esterase/lipase At2g04570 OS=Arabidopsis thaliana GN=At2g04570 PE=2 SV=1 1 290 1.0E-08
sp|Q9SF94|GDL50_ARATH GDSL esterase/lipase At3g09930 OS=Arabidopsis thaliana GN=At3g09930 PE=2 SV=1 28 278 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.37 0.00 1.07
CcL In ants, during behavior modification 1.77 0.00 3.76
CcD In ants, recently dead 2.58 0.19 4.96

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.076867 no
SC16a CcD 0.044432 yes
CcL CcD 0.507372 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7147
MAYILLPFCLLLATASAAPIVRSGYSALVVFGDSFSDNGNGYASTKHAWPADPAYYQGRFSNGPVWPEDLAATLS
TPLHDYAQGGATTDNAMVQGYTGRKGDIPVPSLTDQVNQFLAKPPVDLASSLVILFGGVNDVLLNSNITAARSAG
VIGRLVSKLRDAGALHFVLVNVPDLSLIPYDAYIDDGLQAVLRDYAEHLGGHLRRVAQRISSASVKVVDMIPLFR
SFNVYEKGWKAAGFDQFGLYGSCLVGAYSEAPRSLCSDPDRRVFWDVYHPSRKTHALMAEEIRKAL
Coding >Ophio5|7147
ATGGCATACATCCTCCTCCCTTTCTGCCTGCTACTGGCAACCGCGTCGGCCGCCCCAATCGTTAGGTCCGGATAC
TCGGCCCTCGTCGTCTTCGGAGACTCCTTCTCAGACAACGGCAACGGCTACGCAAGCACAAAACATGCCTGGCCC
GCCGATCCGGCCTACTATCAAGGCCGCTTCTCTAACGGCCCCGTCTGGCCCGAGGATTTGGCCGCGACACTCTCC
ACCCCCCTGCACGACTACGCTCAAGGCGGCGCCACCACTGACAACGCCATGGTTCAAGGCTATACTGGGCGAAAA
GGCGACATCCCCGTACCGTCGCTGACAGACCAGGTCAACCAATTCCTCGCGAAGCCGCCCGTCGACCTCGCCAGC
TCCCTGGTCATTCTTTTTGGCGGTGTCAATGACGTTCTCCTCAACTCCAACATCACCGCCGCCCGCTCGGCCGGA
GTTATCGGCCGGCTCGTCAGCAAGCTTCGAGACGCTGGTGCACTTCACTTCGTCTTGGTCAACGTTCCGGACCTC
AGCTTGATCCCGTACGACGCGTACATTGATGACGGGTTGCAAGCCGTTCTACGTGACTATGCCGAGCACCTTGGC
GGCCATCTCCGGAGAGTTGCACAACGTATCAGCTCGGCGAGCGTCAAGGTCGTCGACATGATCCCCCTCTTCCGC
AGCTTCAACGTCTACGAAAAGGGCTGGAAGGCTGCAGGCTTTGACCAATTCGGCCTTTACGGAAGCTGTCTAGTA
GGCGCCTATTCCGAGGCGCCGCGCTCGCTCTGTAGCGATCCCGATCGGCGCGTCTTCTGGGACGTGTATCATCCG
TCTCGGAAGACGCACGCTCTCATGGCCGAGGAGATTAGAAAGGCTCTG
Transcript >Ophio5|7147
ATGGCATACATCCTCCTCCCTTTCTGCCTGCTACTGGCAACCGCGTCGGCCGCCCCAATCGTTAGGTCCGGATAC
TCGGCCCTCGTCGTCTTCGGAGACTCCTTCTCAGACAACGGCAACGGCTACGCAAGCACAAAACATGCCTGGCCC
GCCGATCCGGCCTACTATCAAGGCCGCTTCTCTAACGGCCCCGTCTGGCCCGAGGATTTGGCCGCGACACTCTCC
ACCCCCCTGCACGACTACGCTCAAGGCGGCGCCACCACTGACAACGCCATGGTTCAAGGCTATACTGGGCGAAAA
GGCGACATCCCCGTACCGTCGCTGACAGACCAGGTCAACCAATTCCTCGCGAAGCCGCCCGTCGACCTCGCCAGC
TCCCTGGTCATTCTTTTTGGCGGTGTCAATGACGTTCTCCTCAACTCCAACATCACCGCCGCCCGCTCGGCCGGA
GTTATCGGCCGGCTCGTCAGCAAGCTTCGAGACGCTGGTGCACTTCACTTCGTCTTGGTCAACGTTCCGGACCTC
AGCTTGATCCCGTACGACGCGTACATTGATGACGGGTTGCAAGCCGTTCTACGTGACTATGCCGAGCACCTTGGC
GGCCATCTCCGGAGAGTTGCACAACGTATCAGCTCGGCGAGCGTCAAGGTCGTCGACATGATCCCCCTCTTCCGC
AGCTTCAACGTCTACGAAAAGGGCTGGAAGGCTGCAGGCTTTGACCAATTCGGCCTTTACGGAAGCTGTCTAGTA
GGCGCCTATTCCGAGGCGCCGCGCTCGCTCTGTAGCGATCCCGATCGGCGCGTCTTCTGGGACGTGTATCATCCG
TCTCGGAAGACGCACGCTCTCATGGCCGAGGAGATTAGAAAGGCTCTGTAG
Gene >Ophio5|7147
ATGGCATACATCCTCCTCCCTTTCTGCCTGCTACTGGCAACCGCGTCGGCCGCCCCAATCGTTAGGTCCGGATAC
TCGGCCCTCGTCGTCTTCGGAGACTCCTTCTCAGACAACGGCAACGGCTACGCAAGCACAAAACATGCCTGGCCC
GCCGATCCGGCCTACTATCAAGGCCGCTTCTCTAACGGCCCCGTCTGGCCCGAGGATTTGGCCGCGACACTCTCC
ACCCCCCTGCACGACTACGCTCAAGGCGGCGCCACCACTGACAACGCCATGGTTCAAGGCTATACTGGGCGAAAA
GGCGACATCCCCGTACCGTCGCTGACAGACCAGGTCAACCAATTCCTCGCGAAGCCGCCCGTCGACCTCGCCAGC
TCCCTGGTCATTCTTTTTGGCGGTGTCAATGACGTTCTCCTCAACTCCAACATCACCGCCGCCCGCTCGGCCGGA
GTTATCGGCCGGCTCGTCAGCAAGCTTCGAGACGCTGGTGCACTTCACTTCGTCTTGGTCAACGTTCCGGACCTC
AGCTTGATCCCGTACGACGCGTACATTGATGACGGGTTGCAAGCCGTTCTACGTGACTATGCCGAGCACCTTGGC
GGCCATCTCCGGAGAGTTGCACAACGTATCAGCTCGGCGAGCGTCAAGGTCGTCGACATGATCCCCCTCTTCCGC
AGCTTCAACGTCTACGAAAAGGGCTGGAAGGCTGCAGGCTTTGACCAATTCGGCCTTTACGGAAGCTGTCTAGTA
GGCGCCTATTCCGAGGCGCCGCGCTCGCTCTGTAGCGATCCCGATCGGCGCGTCTTCTGGGACGTGTATCATCCG
TCTCGGAAGACGCACGCTCTCATGGCCGAGGAGATTAGAAAGGCTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail