Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7146
Gene name
Locationscaffold_67:27023..29216
Strand-
Gene length (bp)2193
Transcript length (bp)2193
Coding sequence length (bp)2190
Protein length (aa) 730

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00382 TFIIB Transcription factor TFIIB repeat 2.3E-11 131 220
PF00382 TFIIB Transcription factor TFIIB repeat 5.2E-24 234 318
PF07741 BRF1 Brf1-like TBP-binding domain 1.1E-24 553 651

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6R0|TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brf1 PE=1 SV=2 58 359 1.0E-67
sp|P43072|TF3B_CANAL Transcription factor IIIB 70 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TDS4 PE=3 SV=1 70 346 2.0E-60
sp|Q8CFK2|TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus GN=Brf1 PE=1 SV=1 70 386 7.0E-60
sp|P29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRF1 PE=1 SV=1 70 359 2.0E-59
sp|Q92994|TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1 70 386 5.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6R0|TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brf1 PE=1 SV=2 58 359 1.0E-67
sp|P43072|TF3B_CANAL Transcription factor IIIB 70 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TDS4 PE=3 SV=1 70 346 2.0E-60
sp|Q8CFK2|TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus GN=Brf1 PE=1 SV=1 70 386 7.0E-60
sp|P29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRF1 PE=1 SV=1 70 359 2.0E-59
sp|Q92994|TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1 70 386 5.0E-58
sp|P46070|TF3B_KLULA Transcription factor IIIB 70 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TDS4 PE=3 SV=2 73 331 7.0E-57
sp|Q9HJM7|TF2B1_THEAC Transcription initiation factor IIB 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tfbA PE=3 SV=1 121 319 4.0E-15
sp|Q979Q3|TF2B1_THEVO Transcription initiation factor IIB 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tfbA PE=3 SV=1 121 318 2.0E-13
sp|O28970|TF2B_ARCFU Transcription initiation factor IIB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tfb PE=3 SV=1 121 318 5.0E-13
sp|Q9Y942|TF2B_AERPE Transcription initiation factor IIB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tfb PE=3 SV=2 130 318 5.0E-13
sp|Q2NEL6|TF2B_METST Transcription initiation factor IIB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tfb PE=3 SV=1 156 319 6.0E-13
sp|O26971|TF2B_METTH Transcription initiation factor IIB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tfb PE=3 SV=1 156 319 2.0E-12
sp|A5UKA1|TF2B_METS3 Transcription initiation factor IIB OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tfb PE=3 SV=1 156 319 6.0E-12
sp|P50387|TF2B_SULSH Transcription initiation factor IIB OS=Sulfolobus shibatae GN=tfb PE=3 SV=1 130 319 8.0E-12
sp|O59151|TF2B_PYRHO Transcription initiation factor IIB OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tfb PE=3 SV=1 146 318 9.0E-12
sp|Q5JGN1|TF2B1_THEKO Transcription initiation factor IIB 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tfb1 PE=3 SV=1 157 318 9.0E-12
sp|P61999|TF2B_PYRWO Transcription initiation factor IIB OS=Pyrococcus woesei GN=tfb PE=1 SV=1 157 318 1.0E-11
sp|P61998|TF2B_PYRFU Transcription initiation factor IIB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tfb PE=1 SV=1 157 318 1.0E-11
sp|P58111|TF2B1_SULSO Transcription initiation factor IIB 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tfbA PE=3 SV=1 130 319 2.0E-11
sp|Q9V0V5|TF2B_PYRAB Transcription initiation factor IIB OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tfb PE=3 SV=1 146 318 2.0E-11
sp|Q9HHK5|TF2B3_HALSA Transcription initiation factor IIB 3 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbC PE=3 SV=1 144 317 4.0E-11
sp|Q9HSF7|TF2B7_HALSA Transcription initiation factor IIB 7 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbG PE=3 SV=1 144 317 8.0E-10
sp|Q8TX21|TF2B_METKA Transcription initiation factor IIB OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tfb PE=3 SV=1 122 318 9.0E-10
sp|Q9P9I7|TF2B_METTL Transcription initiation factor IIB OS=Methanothermococcus thermolithotrophicus GN=tfb PE=3 SV=1 121 319 1.0E-09
sp|A6UW60|TF2B_META3 Transcription initiation factor IIB OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tfb PE=3 SV=1 121 319 1.0E-09
sp|Q58192|TF2B_METJA Transcription initiation factor IIB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tfb PE=3 SV=1 160 318 1.0E-09
sp|A8AC96|TF2B_IGNH4 Transcription initiation factor IIB OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tfb PE=3 SV=1 122 334 2.0E-09
sp|A6VI28|TF2B_METM7 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tfb PE=3 SV=1 121 319 3.0E-09
sp|A9A8Q0|TF2B_METM6 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tfb PE=3 SV=1 121 319 3.0E-09
sp|Q979P7|TF2B2_THEVO Transcription initiation factor IIB 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tfbB PE=3 SV=1 122 330 3.0E-09
sp|Q6M176|TF2B_METMP Transcription initiation factor IIB OS=Methanococcus maripaludis (strain S2 / LL) GN=tfb PE=3 SV=1 121 319 5.0E-09
sp|Q9HJM2|TF2B2_THEAC Transcription initiation factor IIB 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tfbB PE=3 SV=1 122 330 6.0E-09
sp|A4G0F2|TF2B_METM5 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tfb PE=3 SV=1 121 319 2.0E-08
sp|Q9HRE6|TF2B2_HALSA Transcription initiation factor IIB 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbB PE=3 SV=1 129 318 4.0E-08
sp|Q9HNA2|TF2B1_HALSA Transcription initiation factor IIB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbA PE=3 SV=1 147 319 5.0E-08
sp|A3CSQ6|TF2B_METMJ Transcription initiation factor IIB OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tfb PE=3 SV=1 160 318 6.0E-08
sp|Q975S1|TF2B_SULTO Transcription initiation factor IIB OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tfb PE=3 SV=1 130 319 6.0E-08
sp|B8GJQ9|TF2B_METPE Transcription initiation factor IIB OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tfb PE=3 SV=1 121 318 7.0E-08
sp|A7IAR4|TF2B_METB6 Transcription initiation factor IIB OS=Methanoregula boonei (strain 6A8) GN=tfb PE=3 SV=1 160 318 7.0E-08
sp|Q9UWN6|TF2B_SULAC Transcription initiation factor IIB OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tfb PE=3 SV=2 130 319 5.0E-07
sp|A0B5T8|TF2B_METTP Transcription initiation factor IIB OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tfb PE=3 SV=1 121 318 8.0E-07
sp|Q9HHH8|TF2B5_HALSA Transcription initiation factor IIB 5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbE PE=3 SV=1 143 313 2.0E-06
sp|Q9HSB3|TF2B6_HALSA Transcription initiation factor IIB 6 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbF PE=3 SV=1 129 318 2.0E-06
sp|A8MCX6|TF2B_CALMQ Transcription initiation factor IIB OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tfb PE=3 SV=1 122 318 3.0E-06
sp|Q8SRP3|TF2B_ENCCU Transcription initiation factor IIB OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_1100i PE=3 SV=1 130 318 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0017025 TBP-class protein binding Yes
GO:0140296 general transcription initiation factor binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0008134 transcription factor binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2346 0.9162 0.0304 0.0269 0.0413 0.003 0.0196 0.0127 0.0326 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2541
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1365
Ophiocordyceps australis map64 (Brazil) OphauB2|3477
Ophiocordyceps camponoti-floridani Ophcf2|04573
Ophiocordyceps camponoti-rufipedis Ophun1|6774
Ophiocordyceps kimflemingae Ophio5|7146 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3756

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7146
MPPSLPTARRAGGPQPRFSRPNPVRAMREREERRRAEQHQQVPNSRSGAVAAPARAQCPNKACPKPNVVDGTCQT
CGRVADESNIVAEVQFGETSSGAAMVQGSFVGADQAGVRSMGPAFRRVGGSEDRDKSIREARGLMQGYAQQLNVG
DGLVTAGTQVFKLASSANFVQGRTLASVAAVCLYAACRAAPPCKVMLIDLADLVQLNVFKLGRIFKKLNEVVPIG
NDGLIPVYPEDLIWRFATKMEFHQDTAKVAEDAVRLVKRMSRDWMVMGRRPSGICGACLLMAARMHNFRRTVREV
VYIVKVTNHTIQNRLQEFNFTASSNMSVEDFLKQDFLESSHDPPSFYRKSEEYRKQAESRSRKRKHGSDVDDEDG
ENQDVEGETNRDGHGPPEQRQDSRQRPLNDGGADLSRAPAVEFRRDADGFIIPPLPSQIQRDGEDKTTTTTTTTT
ATADNGDESLARLASEFGDALDEDDDDVRRRARPQLPINDEWEQDEEELEGQIEEIFNDPLTYEHALAYSNAEQR
ARIHSTWAFKQRPLKEVSMAATIEEDEFANDPEVANCLLSPDEARIKELIWVNQNKDWLRKHQEKVFRRKVEADR
PKQTRRRRKRARMGEGQTSPASSAAEAAINVAKDRAWSKRINYDAIRSIFDAPNAGLGSAATSRKTSVAGSVLGV
GPEDEEEDDDEEEEESEAGDEGGAEPEPDFEGAGDDFDEYDNPELDAEYGLDQDG
Coding >Ophio5|7146
ATGCCACCGTCGCTCCCTACGGCCAGGCGGGCCGGCGGACCTCAGCCGCGCTTTTCCAGGCCGAATCCCGTGCGG
GCGATGAGGGAACGGGAGGAGAGGCGTCGTGCAGAGCAGCATCAGCAGGTTCCGAATAGTCGCAGTGGTGCTGTG
GCGGCCCCGGCGAGAGCTCAGTGTCCCAACAAGGCATGTCCGAAGCCGAATGTCGTCGACGGAACCTGTCAGACG
TGTGGCCGCGTGGCGGATGAGAGCAACATCGTGGCCGAGGTTCAGTTTGGAGAGACTTCTTCGGGAGCTGCCATG
GTTCAGGGCTCTTTTGTAGGGGCCGATCAGGCCGGCGTTCGCTCCATGGGTCCGGCCTTTCGTCGAGTCGGTGGC
TCCGAGGATCGTGACAAGAGCATCAGAGAGGCTCGTGGGCTCATGCAGGGCTACGCGCAGCAGCTCAACGTCGGC
GACGGCCTCGTCACGGCCGGCACTCAGGTCTTCAAGCTGGCTTCGAGCGCAAACTTCGTCCAGGGCCGTACCCTC
GCCAGCGTTGCCGCAGTCTGTCTCTACGCCGCCTGTCGTGCTGCTCCCCCTTGCAAGGTGATGCTCATCGACCTG
GCAGACTTGGTTCAGCTCAACGTGTTCAAGCTGGGTCGCATCTTCAAGAAGCTCAACGAAGTGGTTCCCATCGGC
AATGACGGCCTCATCCCCGTCTATCCGGAGGATCTCATCTGGCGCTTCGCCACCAAGATGGAGTTTCACCAGGAT
ACGGCTAAGGTGGCCGAGGATGCCGTTCGACTGGTTAAACGCATGAGTCGCGATTGGATGGTCATGGGACGGAGG
CCGTCGGGCATCTGCGGTGCTTGTCTGCTCATGGCAGCTCGTATGCACAACTTCCGCCGCACCGTTCGCGAGGTC
GTTTACATTGTCAAGGTGACCAATCACACCATTCAGAACCGGCTTCAGGAGTTCAACTTTACTGCCTCCAGCAAC
ATGTCGGTCGAGGACTTTCTTAAGCAAGACTTTCTCGAGAGCTCTCATGACCCGCCCTCCTTCTACCGCAAGTCG
GAAGAGTACCGGAAACAGGCTGAGAGCAGGTCGCGGAAGCGGAAACACGGCAGTGACGTCGACGATGAGGACGGG
GAGAATCAGGACGTCGAGGGGGAGACCAACCGAGACGGACATGGTCCACCGGAACAAAGACAAGACAGCCGTCAA
CGGCCCCTGAACGACGGTGGCGCCGATCTCTCAAGAGCCCCGGCGGTTGAGTTTCGACGCGACGCCGACGGCTTC
ATCATTCCACCGCTGCCATCCCAGATCCAGCGAGACGGCGAGGACAAGACGACGACGACGACGACGACGACTACT
GCGACGGCTGACAACGGCGACGAGAGTCTCGCGCGGCTGGCCAGTGAATTCGGCGATGCCCTCGACGAAGACGAC
GATGATGTCCGCCGTCGCGCCAGGCCCCAGCTTCCCATCAACGACGAGTGGGAGCAGGACGAGGAGGAGCTCGAG
GGGCAGATTGAGGAAATCTTCAACGATCCCCTGACGTACGAACACGCCCTCGCCTACTCCAACGCCGAGCAGAGG
GCCAGGATACACTCGACGTGGGCCTTCAAGCAGCGGCCCCTCAAGGAGGTGTCGATGGCGGCCACCATTGAGGAG
GATGAGTTCGCCAACGACCCAGAGGTGGCCAACTGCCTGCTATCGCCGGACGAGGCGCGCATCAAGGAGCTCATC
TGGGTCAACCAGAACAAGGACTGGCTACGGAAGCACCAGGAGAAGGTCTTTCGGCGAAAGGTCGAGGCGGACCGG
CCCAAGCAGACGCGGCGTCGACGAAAACGAGCTCGCATGGGCGAGGGTCAGACGAGCCCGGCGAGTTCGGCGGCC
GAGGCGGCCATTAACGTGGCCAAGGATCGGGCATGGTCCAAGAGGATCAACTACGACGCCATCAGAAGCATCTTT
GACGCGCCCAACGCGGGATTGGGGTCGGCAGCGACGAGCCGCAAGACGAGCGTGGCGGGCAGCGTCCTGGGCGTC
GGGCCGGAGGATGAGGAGGAGGATGATGATGAAGAGGAGGAGGAGAGCGAGGCCGGGGACGAGGGAGGCGCGGAG
CCGGAGCCGGACTTCGAGGGGGCCGGGGACGACTTTGACGAATACGATAACCCGGAGCTGGACGCCGAGTACGGA
CTCGATCAGGATGGA
Transcript >Ophio5|7146
ATGCCACCGTCGCTCCCTACGGCCAGGCGGGCCGGCGGACCTCAGCCGCGCTTTTCCAGGCCGAATCCCGTGCGG
GCGATGAGGGAACGGGAGGAGAGGCGTCGTGCAGAGCAGCATCAGCAGGTTCCGAATAGTCGCAGTGGTGCTGTG
GCGGCCCCGGCGAGAGCTCAGTGTCCCAACAAGGCATGTCCGAAGCCGAATGTCGTCGACGGAACCTGTCAGACG
TGTGGCCGCGTGGCGGATGAGAGCAACATCGTGGCCGAGGTTCAGTTTGGAGAGACTTCTTCGGGAGCTGCCATG
GTTCAGGGCTCTTTTGTAGGGGCCGATCAGGCCGGCGTTCGCTCCATGGGTCCGGCCTTTCGTCGAGTCGGTGGC
TCCGAGGATCGTGACAAGAGCATCAGAGAGGCTCGTGGGCTCATGCAGGGCTACGCGCAGCAGCTCAACGTCGGC
GACGGCCTCGTCACGGCCGGCACTCAGGTCTTCAAGCTGGCTTCGAGCGCAAACTTCGTCCAGGGCCGTACCCTC
GCCAGCGTTGCCGCAGTCTGTCTCTACGCCGCCTGTCGTGCTGCTCCCCCTTGCAAGGTGATGCTCATCGACCTG
GCAGACTTGGTTCAGCTCAACGTGTTCAAGCTGGGTCGCATCTTCAAGAAGCTCAACGAAGTGGTTCCCATCGGC
AATGACGGCCTCATCCCCGTCTATCCGGAGGATCTCATCTGGCGCTTCGCCACCAAGATGGAGTTTCACCAGGAT
ACGGCTAAGGTGGCCGAGGATGCCGTTCGACTGGTTAAACGCATGAGTCGCGATTGGATGGTCATGGGACGGAGG
CCGTCGGGCATCTGCGGTGCTTGTCTGCTCATGGCAGCTCGTATGCACAACTTCCGCCGCACCGTTCGCGAGGTC
GTTTACATTGTCAAGGTGACCAATCACACCATTCAGAACCGGCTTCAGGAGTTCAACTTTACTGCCTCCAGCAAC
ATGTCGGTCGAGGACTTTCTTAAGCAAGACTTTCTCGAGAGCTCTCATGACCCGCCCTCCTTCTACCGCAAGTCG
GAAGAGTACCGGAAACAGGCTGAGAGCAGGTCGCGGAAGCGGAAACACGGCAGTGACGTCGACGATGAGGACGGG
GAGAATCAGGACGTCGAGGGGGAGACCAACCGAGACGGACATGGTCCACCGGAACAAAGACAAGACAGCCGTCAA
CGGCCCCTGAACGACGGTGGCGCCGATCTCTCAAGAGCCCCGGCGGTTGAGTTTCGACGCGACGCCGACGGCTTC
ATCATTCCACCGCTGCCATCCCAGATCCAGCGAGACGGCGAGGACAAGACGACGACGACGACGACGACGACTACT
GCGACGGCTGACAACGGCGACGAGAGTCTCGCGCGGCTGGCCAGTGAATTCGGCGATGCCCTCGACGAAGACGAC
GATGATGTCCGCCGTCGCGCCAGGCCCCAGCTTCCCATCAACGACGAGTGGGAGCAGGACGAGGAGGAGCTCGAG
GGGCAGATTGAGGAAATCTTCAACGATCCCCTGACGTACGAACACGCCCTCGCCTACTCCAACGCCGAGCAGAGG
GCCAGGATACACTCGACGTGGGCCTTCAAGCAGCGGCCCCTCAAGGAGGTGTCGATGGCGGCCACCATTGAGGAG
GATGAGTTCGCCAACGACCCAGAGGTGGCCAACTGCCTGCTATCGCCGGACGAGGCGCGCATCAAGGAGCTCATC
TGGGTCAACCAGAACAAGGACTGGCTACGGAAGCACCAGGAGAAGGTCTTTCGGCGAAAGGTCGAGGCGGACCGG
CCCAAGCAGACGCGGCGTCGACGAAAACGAGCTCGCATGGGCGAGGGTCAGACGAGCCCGGCGAGTTCGGCGGCC
GAGGCGGCCATTAACGTGGCCAAGGATCGGGCATGGTCCAAGAGGATCAACTACGACGCCATCAGAAGCATCTTT
GACGCGCCCAACGCGGGATTGGGGTCGGCAGCGACGAGCCGCAAGACGAGCGTGGCGGGCAGCGTCCTGGGCGTC
GGGCCGGAGGATGAGGAGGAGGATGATGATGAAGAGGAGGAGGAGAGCGAGGCCGGGGACGAGGGAGGCGCGGAG
CCGGAGCCGGACTTCGAGGGGGCCGGGGACGACTTTGACGAATACGATAACCCGGAGCTGGACGCCGAGTACGGA
CTCGATCAGGATGGATAG
Gene >Ophio5|7146
ATGCCACCGTCGCTCCCTACGGCCAGGCGGGCCGGCGGACCTCAGCCGCGCTTTTCCAGGCCGAATCCCGTGCGG
GCGATGAGGGAACGGGAGGAGAGGCGTCGTGCAGAGCAGCATCAGCAGGTTCCGAATAGTCGCAGTGGTGCTGTG
GCGGCCCCGGCGAGAGCTCAGTGTCCCAACAAGGCATGTCCGAAGCCGAATGTCGTCGACGGAACCTGTCAGACG
TGTGGCCGCGTGGCGGATGAGAGCAACATCGTGGCCGAGGTTCAGTTTGGAGAGACTTCTTCGGGAGCTGCCATG
GTTCAGGGCTCTTTTGTAGGGGCCGATCAGGCCGGCGTTCGCTCCATGGGTCCGGCCTTTCGTCGAGTCGGTGGC
TCCGAGGATCGTGACAAGAGCATCAGAGAGGCTCGTGGGCTCATGCAGGGCTACGCGCAGCAGCTCAACGTCGGC
GACGGCCTCGTCACGGCCGGCACTCAGGTCTTCAAGCTGGCTTCGAGCGCAAACTTCGTCCAGGGCCGTACCCTC
GCCAGCGTTGCCGCAGTCTGTCTCTACGCCGCCTGTCGTGCTGCTCCCCCTTGCAAGGTGATGCTCATCGACCTG
GCAGACTTGGTTCAGCTCAACGTGTTCAAGCTGGGTCGCATCTTCAAGAAGCTCAACGAAGTGGTTCCCATCGGC
AATGACGGCCTCATCCCCGTCTATCCGGAGGATCTCATCTGGCGCTTCGCCACCAAGATGGAGTTTCACCAGGAT
ACGGCTAAGGTGGCCGAGGATGCCGTTCGACTGGTTAAACGCATGAGTCGCGATTGGATGGTCATGGGACGGAGG
CCGTCGGGCATCTGCGGTGCTTGTCTGCTCATGGCAGCTCGTATGCACAACTTCCGCCGCACCGTTCGCGAGGTC
GTTTACATTGTCAAGGTGACCAATCACACCATTCAGAACCGGCTTCAGGAGTTCAACTTTACTGCCTCCAGCAAC
ATGTCGGTCGAGGACTTTCTTAAGCAAGACTTTCTCGAGAGCTCTCATGACCCGCCCTCCTTCTACCGCAAGTCG
GAAGAGTACCGGAAACAGGCTGAGAGCAGGTCGCGGAAGCGGAAACACGGCAGTGACGTCGACGATGAGGACGGG
GAGAATCAGGACGTCGAGGGGGAGACCAACCGAGACGGACATGGTCCACCGGAACAAAGACAAGACAGCCGTCAA
CGGCCCCTGAACGACGGTGGCGCCGATCTCTCAAGAGCCCCGGCGGTTGAGTTTCGACGCGACGCCGACGGCTTC
ATCATTCCACCGCTGCCATCCCAGATCCAGCGAGACGGCGAGGACAAGACGACGACGACGACGACGACGACTACT
GCGACGGCTGACAACGGCGACGAGAGTCTCGCGCGGCTGGCCAGTGAATTCGGCGATGCCCTCGACGAAGACGAC
GATGATGTCCGCCGTCGCGCCAGGCCCCAGCTTCCCATCAACGACGAGTGGGAGCAGGACGAGGAGGAGCTCGAG
GGGCAGATTGAGGAAATCTTCAACGATCCCCTGACGTACGAACACGCCCTCGCCTACTCCAACGCCGAGCAGAGG
GCCAGGATACACTCGACGTGGGCCTTCAAGCAGCGGCCCCTCAAGGAGGTGTCGATGGCGGCCACCATTGAGGAG
GATGAGTTCGCCAACGACCCAGAGGTGGCCAACTGCCTGCTATCGCCGGACGAGGCGCGCATCAAGGAGCTCATC
TGGGTCAACCAGAACAAGGACTGGCTACGGAAGCACCAGGAGAAGGTCTTTCGGCGAAAGGTCGAGGCGGACCGG
CCCAAGCAGACGCGGCGTCGACGAAAACGAGCTCGCATGGGCGAGGGTCAGACGAGCCCGGCGAGTTCGGCGGCC
GAGGCGGCCATTAACGTGGCCAAGGATCGGGCATGGTCCAAGAGGATCAACTACGACGCCATCAGAAGCATCTTT
GACGCGCCCAACGCGGGATTGGGGTCGGCAGCGACGAGCCGCAAGACGAGCGTGGCGGGCAGCGTCCTGGGCGTC
GGGCCGGAGGATGAGGAGGAGGATGATGATGAAGAGGAGGAGGAGAGCGAGGCCGGGGACGAGGGAGGCGCGGAG
CCGGAGCCGGACTTCGAGGGGGCCGGGGACGACTTTGACGAATACGATAACCCGGAGCTGGACGCCGAGTACGGA
CTCGATCAGGATGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail