Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7136
Gene name
Locationscaffold_67:4918..5858
Strand+
Gene length (bp)940
Transcript length (bp)885
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05093 CIAPIN1 Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis 3.1E-38 195 287
PF16803 DRE2_N Fe-S cluster assembly protein DRE2 N-terminus 1.3E-31 20 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B6H9W0|DRE2_PENRW Fe-S cluster assembly protein dre2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dre2 PE=3 SV=1 1 294 6.0E-109
sp|Q0C7M4|DRE2_ASPTN Fe-S cluster assembly protein dre2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dre2 PE=3 SV=1 14 294 1.0E-108
sp|B8M072|DRE2_TALSN Fe-S cluster assembly protein dre2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dre2 PE=3 SV=1 20 294 1.0E-102
sp|B8NL00|DRE2_ASPFN Fe-S cluster assembly protein dre2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dre2 PE=3 SV=1 20 294 3.0E-102
sp|Q2U5K2|DRE2_ASPOR Fe-S cluster assembly protein dre2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dre2 PE=3 SV=1 20 294 1.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B6H9W0|DRE2_PENRW Fe-S cluster assembly protein dre2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dre2 PE=3 SV=1 1 294 6.0E-109
sp|Q0C7M4|DRE2_ASPTN Fe-S cluster assembly protein dre2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dre2 PE=3 SV=1 14 294 1.0E-108
sp|B8M072|DRE2_TALSN Fe-S cluster assembly protein dre2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dre2 PE=3 SV=1 20 294 1.0E-102
sp|B8NL00|DRE2_ASPFN Fe-S cluster assembly protein dre2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dre2 PE=3 SV=1 20 294 3.0E-102
sp|Q2U5K2|DRE2_ASPOR Fe-S cluster assembly protein dre2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dre2 PE=3 SV=1 20 294 1.0E-101
sp|B6QAR7|DRE2_TALMQ Fe-S cluster assembly protein dre2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dre2 PE=3 SV=1 4 294 4.0E-98
sp|Q5AT95|DRE2_EMENI Fe-S cluster assembly protein dre2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dre2 PE=3 SV=1 1 294 2.0E-97
sp|A2QEP2|DRE2_ASPNC Fe-S cluster assembly protein dre2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dre2 PE=3 SV=1 1 294 3.0E-93
sp|B2B763|DRE2_PODAN Fe-S cluster assembly protein DRE2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DRE2 PE=3 SV=1 20 294 5.0E-87
sp|Q871G3|DRE2_NEUCR Fe-S cluster assembly protein dre2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dre2 PE=3 SV=1 4 294 2.0E-84
sp|A7EYZ4|DRE2_SCLS1 Fe-S cluster assembly protein dre2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dre2 PE=3 SV=1 20 294 1.0E-83
sp|A6SCX6|DRE2_BOTFB Fe-S cluster assembly protein dre2 OS=Botryotinia fuckeliana (strain B05.10) GN=dre2 PE=3 SV=1 20 294 3.0E-76
sp|B2W1T4|DRE2_PYRTR Fe-S cluster assembly protein dre2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=dre2 PE=3 SV=1 20 294 2.0E-74
sp|Q0UTA2|DRE2_PHANO Fe-S cluster assembly protein DRE2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRE2 PE=3 SV=2 20 294 3.0E-71
sp|C4JTA0|DRE2_UNCRE Fe-S cluster assembly protein DRE2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=DRE2 PE=3 SV=1 20 294 5.0E-69
sp|C7YRS7|DRE2_NECH7 Fe-S cluster assembly protein DRE2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DRE2 PE=3 SV=1 20 294 5.0E-69
sp|A4RE46|DRE2_MAGO7 Fe-S cluster assembly protein DRE2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRE2 PE=3 SV=1 49 294 5.0E-67
sp|B0XPZ4|DRE2_ASPFC Fe-S cluster assembly protein dre2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dre2 PE=3 SV=1 35 294 5.0E-66
sp|A1D3K3|DRE2_NEOFI Fe-S cluster assembly protein dre2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dre2 PE=3 SV=1 35 294 6.0E-64
sp|A1CQP0|DRE2_ASPCL Fe-S cluster assembly protein dre2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dre2 PE=3 SV=2 18 294 6.0E-62
sp|C5K3T8|DRE2_AJEDS Fe-S cluster assembly protein DRE2 OS=Ajellomyces dermatitidis (strain SLH14081) GN=DRE2 PE=3 SV=1 17 294 8.0E-62
sp|C5GYL7|DRE2_AJEDR Fe-S cluster assembly protein DRE2 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DRE2 PE=3 SV=1 17 294 8.0E-62
sp|Q1DR42|DRE2_COCIM Fe-S cluster assembly protein DRE2 OS=Coccidioides immitis (strain RS) GN=DRE2 PE=3 SV=1 20 294 5.0E-61
sp|C5P664|DRE2_COCP7 Fe-S cluster assembly protein DRE2 OS=Coccidioides posadasii (strain C735) GN=DRE2 PE=3 SV=1 20 294 5.0E-61
sp|C5FFE1|DRE2_ARTOC Fe-S cluster assembly protein DRE2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DRE2 PE=3 SV=1 34 294 1.0E-60
sp|A6QXB4|DRE2_AJECN Fe-S cluster assembly protein DRE2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DRE2 PE=3 SV=1 17 294 6.0E-57
sp|C1GP53|DRE2_PARBA Fe-S cluster assembly protein DRE2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DRE2 PE=3 SV=1 17 294 6.0E-57
sp|C1G2L9|DRE2_PARBD Fe-S cluster assembly protein DRE2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=DRE2 PE=3 SV=1 187 294 4.0E-42
sp|Q2GYB6|DRE2_CHAGB Fe-S cluster assembly protein DRE2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRE2 PE=3 SV=1 182 294 2.0E-41
sp|O74821|DRE2_SCHPO Fe-S cluster assembly protein dre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dre2 PE=3 SV=1 18 285 6.0E-40
sp|C0NQL8|DRE2_AJECG Fe-S cluster assembly protein DRE2 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DRE2 PE=3 SV=1 190 294 3.0E-39
sp|C6HQ96|DRE2_AJECH Fe-S cluster assembly protein DRE2 OS=Ajellomyces capsulatus (strain H143) GN=DRE2 PE=3 SV=1 190 294 4.0E-38
sp|C4QY17|DRE2_PICPG Fe-S cluster assembly protein DRE2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=DRE2 PE=3 SV=1 21 287 2.0E-32
sp|C4Y9X0|DRE2_CLAL4 Fe-S cluster assembly protein DRE2 OS=Clavispora lusitaniae (strain ATCC 42720) GN=DRE2 PE=3 SV=1 22 287 2.0E-29
sp|Q6BQ02|DRE2_DEBHA Fe-S cluster assembly protein DRE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRE2 PE=3 SV=2 20 289 4.0E-29
sp|Q6CJS8|DRE2_KLULA Fe-S cluster assembly protein DRE2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRE2 PE=3 SV=1 169 291 1.0E-28
sp|B6JVP0|DRE2_SCHJY Fe-S cluster assembly protein dre2 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=dre2 PE=3 SV=1 21 287 1.0E-28
sp|Q6CCV4|DRE2_YARLI Fe-S cluster assembly protein DRE2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRE2 PE=3 SV=1 51 287 1.0E-27
sp|Q75EE0|DRE2_ASHGO Fe-S cluster assembly protein DRE2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRE2 PE=3 SV=1 41 287 1.0E-27
sp|A3LQZ8|DRE2_PICST Fe-S cluster assembly protein DRE2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRE2 PE=3 SV=2 150 287 5.0E-27
sp|C5M444|DRE2_CANTT Fe-S cluster assembly protein DRE2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=DRE2 PE=3 SV=1 174 287 6.0E-27
sp|A7TT02|DRE2_VANPO Fe-S cluster assembly protein DRE2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRE2 PE=3 SV=1 172 287 7.0E-25
sp|A5DQ88|DRE2_PICGU Fe-S cluster assembly protein DRE2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRE2 PE=3 SV=2 51 287 8.0E-25
sp|C5DSC9|DRE2_ZYGRC Fe-S cluster assembly protein DRE2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=DRE2 PE=3 SV=1 169 285 2.0E-24
sp|C5DJL0|DRE2_LACTC Fe-S cluster assembly protein DRE2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=DRE2 PE=3 SV=1 157 287 9.0E-24
sp|Q7XQ97|DRE21_ORYSJ Anamorsin homolog 1 OS=Oryza sativa subsp. japonica GN=Os04g0674400 PE=2 SV=2 171 287 7.0E-23
sp|B8ARI7|DRE22_ORYSI Anamorsin homolog 2 OS=Oryza sativa subsp. indica GN=OsI_17963 PE=2 SV=1 171 287 1.0E-22
sp|A2XYW4|DRE21_ORYSI Anamorsin homolog 1 OS=Oryza sativa subsp. indica GN=H0403D02.15 PE=2 SV=1 171 287 1.0E-22
sp|Q7XPW7|DRE22_ORYSJ Anamorsin homolog 2 OS=Oryza sativa subsp. japonica GN=Os04g0682050 PE=2 SV=1 171 287 1.0E-22
sp|B9WL71|DRE2_CANDC Fe-S cluster assembly protein DRE2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=DRE2 PE=3 SV=1 201 287 2.0E-22
sp|Q8WTY4|CPIN1_MOUSE Anamorsin OS=Mus musculus GN=Ciapin1 PE=1 SV=1 156 293 2.0E-21
sp|Q5XID1|CPIN1_RAT Anamorsin OS=Rattus norvegicus GN=Ciapin1 PE=1 SV=1 156 293 2.0E-21
sp|A8QBB1|DRE2_BRUMA Anamorsin homolog OS=Brugia malayi GN=Bm1_48140 PE=3 SV=1 67 287 7.0E-21
sp|A9PBH9|DRE2_POPTR Anamorsin homolog OS=Populus trichocarpa GN=POPTRDRAFT_761104 PE=2 SV=1 48 287 7.0E-21
sp|D1I234|DRE2_VITVI Anamorsin homolog OS=Vitis vinifera GN=VIT_01s0010g01180 PE=3 SV=1 101 287 8.0E-21
sp|B7PP17|DRE2_IXOSC Anamorsin homolog OS=Ixodes scapularis GN=ISCW019144 PE=3 SV=1 171 290 2.0E-20
sp|Q5A218|DRE2_CANAL Fe-S cluster assembly protein DRE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRE2 PE=3 SV=1 201 287 2.0E-20
sp|B7FNA9|DRE2_MEDTR Anamorsin homolog OS=Medicago truncatula PE=2 SV=1 171 287 2.0E-20
sp|Q6FI81|CPIN1_HUMAN Anamorsin OS=Homo sapiens GN=CIAPIN1 PE=1 SV=2 156 290 3.0E-20
sp|C6TKZ5|DRE2_SOYBN Anamorsin homolog OS=Glycine max PE=2 SV=1 171 287 4.0E-20
sp|Q5EAC7|CPIN1_BOVIN Anamorsin OS=Bos taurus GN=CIAPIN1 PE=2 SV=1 149 290 6.0E-20
sp|P0CM12|DRE2_CRYNJ Fe-S cluster assembly protein DRE2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRE2 PE=3 SV=1 180 287 8.0E-20
sp|P0CM13|DRE2_CRYNB Fe-S cluster assembly protein DRE2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRE2 PE=3 SV=1 180 287 8.0E-20
sp|A8X858|DRE2_CAEBR Anamorsin homolog OS=Caenorhabditis briggsae GN=CBG09135 PE=3 SV=2 173 287 4.0E-19
sp|B9RBT0|DRE2_RICCO Anamorsin homolog OS=Ricinus communis GN=RCOM_1680640 PE=3 SV=1 173 287 5.0E-19
sp|B8LK84|DRE21_PICSI Anamorsin homolog 1 OS=Picea sitchensis PE=2 SV=1 172 287 9.0E-19
sp|P41847|DRE2_CAEEL Anamorsin homolog OS=Caenorhabditis elegans GN=T20B12.7 PE=3 SV=1 173 287 1.0E-18
sp|A8NWK4|DRE2_COPC7 Fe-S cluster assembly protein DRE2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=DRE2 PE=3 SV=1 144 287 2.0E-18
sp|O15692|DRE2_DICDI Anamorsin homolog OS=Dictyostelium discoideum GN=rsc43 PE=2 SV=1 68 292 2.0E-18
sp|B0CRU6|DRE2_LACBS Fe-S cluster assembly protein DRE2 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=DRE2 PE=3 SV=1 49 287 3.0E-18
sp|B4MZ79|DRE2_DROWI Anamorsin homolog OS=Drosophila willistoni GN=l(2)35Bg PE=3 SV=1 198 293 3.0E-18
sp|B4JAX0|DRE2_DROGR Anamorsin homolog OS=Drosophila grimshawi GN=l(2)35Bg PE=3 SV=1 198 293 3.0E-18
sp|B4NYT3|DRE2_DROYA Anamorsin homolog OS=Drosophila yakuba GN=l(2)35Bg PE=3 SV=1 198 293 5.0E-18
sp|Q9V3Y2|DRE2_DROME Anamorsin homolog OS=Drosophila melanogaster GN=CIAPIN1 PE=2 SV=1 198 293 6.0E-18
sp|B4Q5Z1|DRE2_DROSI Anamorsin homolog OS=Drosophila simulans GN=l(2)35Bg PE=3 SV=1 198 293 7.0E-18
sp|B4HXL7|DRE2_DROSE Anamorsin homolog OS=Drosophila sechellia GN=l(2)35Bg PE=3 SV=1 198 293 7.0E-18
sp|B3MLC5|DRE2_DROAN Anamorsin homolog OS=Drosophila ananassae GN=l(2)35Bg PE=3 SV=1 198 293 1.0E-17
sp|B3N5N3|DRE2_DROER Anamorsin homolog OS=Drosophila erecta GN=l(2)35Bg PE=3 SV=1 198 293 1.0E-17
sp|Q29P70|DRE2_DROPS Anamorsin homolog OS=Drosophila pseudoobscura pseudoobscura GN=l(2)35Bg PE=3 SV=1 198 293 2.0E-17
sp|B4GK79|DRE2_DROPE Anamorsin homolog OS=Drosophila persimilis GN=l(2)35Bg PE=3 SV=1 198 293 2.0E-17
sp|B4KLC0|DRE2_DROMO Anamorsin homolog OS=Drosophila mojavensis GN=l(2)35Bg PE=3 SV=1 198 293 2.0E-17
sp|Q86E67|DRE2_SCHJA Anamorsin homolog OS=Schistosoma japonicum GN=SJCHGC06006 PE=2 SV=1 79 293 3.0E-17
sp|Q7RJY1|DRE2_PLAYO Anamorsin homolog OS=Plasmodium yoelii yoelii GN=PY03124 PE=3 SV=2 120 287 4.0E-17
sp|C4WXC1|DRE2_ACYPI Anamorsin homolog OS=Acyrthosiphon pisum GN=ACYPI004042 PE=2 SV=2 170 293 5.0E-17
sp|B4LRY2|DRE2_DROVI Anamorsin homolog OS=Drosophila virilis GN=l(2)35Bg PE=3 SV=1 198 293 6.0E-17
sp|Q2GYB6|DRE2_CHAGB Fe-S cluster assembly protein DRE2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRE2 PE=3 SV=1 5 107 1.0E-16
sp|C4PYP8|DRE2_SCHMA Anamorsin homolog OS=Schistosoma mansoni GN=Smp_207000 PE=3 SV=2 149 293 1.0E-16
sp|B6TB21|DRE2_MAIZE Anamorsin homolog OS=Zea mays PE=2 SV=1 182 287 2.0E-16
sp|A8PS95|DRE2_MALGO Fe-S cluster assembly protein DRE2 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=DRE2 PE=3 SV=1 13 287 2.0E-16
sp|B3RVZ1|DRE2_TRIAD Anamorsin homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_55827 PE=3 SV=1 159 293 8.0E-16
sp|A4IHR0|CPIN1_XENTR Anamorsin OS=Xenopus tropicalis GN=ciapin1 PE=2 SV=2 201 289 1.0E-15
sp|Q7PWQ6|DRE2_ANOGA Anamorsin homolog OS=Anopheles gambiae GN=AGAP008883 PE=3 SV=2 198 293 1.0E-15
sp|Q4V7N8|CPIN1_XENLA Anamorsin OS=Xenopus laevis GN=ciapin1 PE=2 SV=2 201 289 1.0E-15
sp|Q17L24|DRE2_AEDAE Anamorsin homolog OS=Aedes aegypti GN=AAEL001501 PE=3 SV=1 198 287 1.0E-15
sp|P36152|DRE2_YEAST Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRE2 PE=1 SV=1 219 287 2.0E-15
sp|C7GX69|DRE2_YEAS2 Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain JAY291) GN=DRE2 PE=3 SV=1 219 287 2.0E-15
sp|C8ZCN3|DRE2_YEAS8 Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=DRE2 PE=3 SV=1 219 287 2.0E-15
sp|A7A031|DRE2_YEAS7 Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRE2 PE=3 SV=1 219 287 2.0E-15
sp|B3LRE5|DRE2_YEAS1 Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DRE2 PE=3 SV=1 219 287 2.0E-15
sp|C3YFB4|DRE2_BRAFL Anamorsin homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_58504 PE=3 SV=1 202 287 3.0E-15
sp|Q4YUG2|DRE2_PLABA Anamorsin homolog OS=Plasmodium berghei (strain Anka) GN=PB000958.02.0 PE=3 SV=1 120 287 4.0E-15
sp|C0NQL8|DRE2_AJECG Fe-S cluster assembly protein DRE2 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DRE2 PE=3 SV=1 17 158 5.0E-15
sp|C6HQ96|DRE2_AJECH Fe-S cluster assembly protein DRE2 OS=Ajellomyces capsulatus (strain H143) GN=DRE2 PE=3 SV=1 17 158 6.0E-15
sp|B5XEX1|CPN1A_SALSA Anamorsin-A OS=Salmo salar GN=ciapin1-1 PE=2 SV=1 202 289 8.0E-15
sp|Q6FTJ8|DRE2_CANGA Fe-S cluster assembly protein DRE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRE2 PE=3 SV=1 219 287 9.0E-15
sp|C4YL88|DRE2_CANAW Fe-S cluster assembly protein DRE2 OS=Candida albicans (strain WO-1) GN=DRE2 PE=3 SV=1 201 287 9.0E-15
sp|C0HBG1|CPN1B_SALSA Anamorsin-B OS=Salmo salar GN=ciapin1-2 PE=2 SV=2 202 289 1.0E-14
sp|C1BH56|CPIN1_ONCMY Anamorsin OS=Oncorhynchus mykiss GN=ciapin1 PE=2 SV=1 202 289 1.0E-14
sp|B3L145|DRE2_PLAKH Anamorsin homolog OS=Plasmodium knowlesi (strain H) GN=PKH_050640 PE=3 SV=1 166 287 2.0E-14
sp|B0WQ75|DRE2_CULQU Anamorsin homolog OS=Culex quinquefasciatus GN=CPIJ009364 PE=3 SV=1 198 293 2.0E-14
sp|A0BV78|DRE21_PARTE Anamorsin homolog 1 OS=Paramecium tetraurelia GN=GSPATT00005691001 PE=3 SV=1 152 294 2.0E-14
sp|Q4N8L0|DRE2_THEPA Anamorsin homolog OS=Theileria parva GN=TP01_0461 PE=3 SV=1 205 287 3.0E-14
sp|Q6AZB3|CPIN1_DANRE Anamorsin OS=Danio rerio GN=ciapin1 PE=2 SV=1 207 289 4.0E-14
sp|A7S710|DRE2_NEMVE Anamorsin homolog OS=Nematostella vectensis GN=v1g167244 PE=3 SV=1 203 287 5.0E-14
sp|C9ZUU9|DRE2_TRYB9 Anamorsin homolog OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_VIII1370 PE=3 SV=1 177 279 7.0E-14
sp|Q582A7|DRE2_TRYB2 Anamorsin homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb927.8.1750 PE=3 SV=1 177 279 7.0E-14
sp|C0H4X5|DRE2_PLAF7 Anamorsin homolog OS=Plasmodium falciparum (isolate 3D7) GN=MAL8P1.31 PE=3 SV=1 170 287 9.0E-14
sp|A5K5K4|DRE2_PLAVS Anamorsin homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_089130 PE=3 SV=1 95 287 1.0E-13
sp|A0CIS3|DRE22_PARTE Anamorsin homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007825001 PE=3 SV=1 173 294 3.0E-13
sp|Q4PEB3|DRE2_USTMA Fe-S cluster assembly protein DRE2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRE2 PE=3 SV=1 4 287 4.0E-13
sp|A9S6X4|DRE21_PHYPA Anamorsin homolog 1 OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_163171 PE=3 SV=1 184 285 7.0E-13
sp|Q8L7Z3|DRE2_ARATH Anamorsin homolog OS=Arabidopsis thaliana GN=At5g18400 PE=1 SV=1 181 293 9.0E-13
sp|A9V767|DRE2_MONBE Anamorsin homolog OS=Monosiga brevicollis GN=33738 PE=3 SV=1 203 287 9.0E-13
sp|Q4UH15|DRE2_THEAN Anamorsin homolog OS=Theileria annulata GN=TA20710 PE=3 SV=1 205 285 2.0E-12
sp|C1G2L9|DRE2_PARBD Fe-S cluster assembly protein DRE2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=DRE2 PE=3 SV=1 17 151 4.0E-12
sp|B8LPG7|DRE22_PICSI Anamorsin homolog 2 OS=Picea sitchensis PE=2 SV=1 184 287 4.0E-12
sp|A4HT41|DRE2_LEIIN Anamorsin homolog OS=Leishmania infantum GN=LinJ07.0210 PE=3 SV=1 178 287 7.0E-12
sp|Q5CKJ0|DRE2_CRYHO Anamorsin homolog OS=Cryptosporidium hominis GN=Chro.60473 PE=3 SV=1 203 289 9.0E-12
sp|B7G267|DRE2_PHATC Anamorsin homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_47020 PE=3 SV=1 204 289 1.0E-11
sp|Q5CWQ7|DRE2_CRYPI Anamorsin homolog OS=Cryptosporidium parvum (strain Iowa II) GN=cgd6_4130 PE=3 SV=1 203 289 1.0E-11
sp|Q4D3B7|DRE21_TRYCC Anamorsin homolog 1 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511393.79 PE=3 SV=1 177 279 1.0E-11
sp|A7AWN0|DRE2_BABBO Anamorsin homolog OS=Babesia bovis GN=BBOV_I003760 PE=3 SV=1 192 287 2.0E-11
sp|Q4DER6|DRE22_TRYCC Anamorsin homolog 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053505071.119 PE=3 SV=1 177 279 2.0E-11
sp|Q01FJ6|DRE2_OSTTA Anamorsin homolog OS=Ostreococcus tauri GN=Ot01g05830 PE=3 SV=1 164 285 4.0E-11
sp|Q4SK88|CPIN1_TETNG Anamorsin OS=Tetraodon nigroviridis GN=ciapin1 PE=3 SV=1 209 292 5.0E-11
sp|D0N381|DRE2_PHYIT Anamorsin homolog OS=Phytophthora infestans (strain T30-4) GN=PITG_05601 PE=3 SV=1 203 289 9.0E-11
sp|A4H4W7|DRE2_LEIBR Anamorsin homolog OS=Leishmania braziliensis GN=LbrM07_V2.0230 PE=3 SV=1 176 287 3.0E-10
sp|Q4QIS1|DRE2_LEIMA Anamorsin homolog OS=Leishmania major GN=LmjF07.0230 PE=3 SV=1 178 287 5.0E-10
sp|B9Q0C2|DRE2_TOXGO Anamorsin homolog OS=Toxoplasma gondii GN=TGVEG_216900 PE=3 SV=2 136 287 5.0E-10
sp|A9SUX2|DRE22_PHYPA Anamorsin homolog 2 OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_215969 PE=3 SV=1 184 287 5.0E-10
sp|B8C4D7|DRE2_THAPS Anamorsin homolog OS=Thalassiosira pseudonana GN=THAPSDRAFT_6461 PE=3 SV=1 204 292 1.0E-09
sp|A4RS24|DRE2_OSTLU Anamorsin homolog OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_29219 PE=3 SV=2 175 287 1.0E-09
sp|Q8SWE5|DRE2_ENCCU Fe-S cluster assembly protein DRE2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DRE2 PE=3 SV=1 179 291 3.0E-09
sp|B7XHF3|DRE2_ENTBH Fe-S cluster assembly protein DRE2 OS=Enterocytozoon bieneusi (strain H348) GN=DRE2 PE=3 SV=1 257 287 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016226 iron-sulfur cluster assembly Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0005737 cytoplasm Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0031163 metallo-sulfur cluster assembly No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0110165 cellular anatomical entity No
GO:0071840 cellular component organization or biogenesis No
GO:0006790 sulfur compound metabolic process No
GO:0022607 cellular component assembly No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7136
MAPSPANDAIAASTKPATGRTLLLAPPSLAAHQDKLQDVFASLDRATCDMHMLDRLSAGLVALPPATYDLVLVLT
GPDGARRPEALDLLSRHVYALLVPSMKSGGSLRFQHGAPLPGDAKEAILAGLVEAGDVFEKPADEEAVVPLRLGK
KGKDPPATSKFDFSQLNGDDDDDDDLVDENDLLSEEDRKRRPTIPVNCQPEKRRRPCKDCTCGLAAKFEAEDRER
RAKATQGLEALKLDANDLNELDFTVKGKTGSCNNCSLGDAFRCSTCPYIGLPAFKPGEEVRILNDVVQL
Coding >Ophio5|7136
ATGGCCCCCTCGCCCGCCAACGACGCCATCGCCGCGTCCACCAAACCCGCCACTGGCCGCACCCTACTTCTCGCC
CCTCCCTCACTCGCCGCCCATCAGGACAAGCTACAAGATGTCTTTGCATCTCTGGACCGCGCAACCTGCGACATG
CACATGCTCGACCGCCTCTCCGCCGGGCTCGTCGCCCTGCCGCCCGCCACGTACGACCTCGTCCTCGTCCTGACG
GGTCCCGACGGCGCGCGTCGGCCCGAGGCCCTCGATCTACTCAGTCGCCACGTCTATGCTTTGCTGGTCCCGTCT
ATGAAGTCTGGTGGGAGTCTGCGCTTTCAACACGGCGCTCCGCTACCCGGAGACGCCAAGGAGGCTATCTTGGCT
GGCTTAGTTGAGGCGGGTGACGTGTTCGAGAAGCCTGCCGATGAAGAAGCGGTTGTGCCGTTGCGGCTTGGGAAG
AAGGGTAAGGATCCGCCGGCGACGTCCAAGTTCGACTTTAGCCAGCTCAACGGCGACGACGACGACGACGACGAC
TTGGTGGATGAAAACGACCTGCTCTCGGAAGAAGACCGCAAGAGACGGCCCACCATACCCGTCAACTGCCAGCCT
GAGAAGCGCAGACGCCCTTGCAAGGACTGTACGTGTGGCCTCGCCGCCAAATTCGAGGCCGAAGACCGTGAGCGA
CGGGCCAAAGCCACCCAGGGCCTCGAAGCGCTTAAGCTCGACGCCAACGACCTCAACGAGCTCGATTTCACCGTC
AAGGGCAAGACAGGCTCGTGCAACAATTGCTCGCTCGGCGACGCTTTCCGCTGCTCGACCTGTCCGTACATTGGC
CTGCCGGCATTTAAGCCTGGGGAGGAGGTACGGATCTTGAATGACGTGGTGCAGCTG
Transcript >Ophio5|7136
ATGGCCCCCTCGCCCGCCAACGACGCCATCGCCGCGTCCACCAAACCCGCCACTGGCCGCACCCTACTTCTCGCC
CCTCCCTCACTCGCCGCCCATCAGGACAAGCTACAAGATGTCTTTGCATCTCTGGACCGCGCAACCTGCGACATG
CACATGCTCGACCGCCTCTCCGCCGGGCTCGTCGCCCTGCCGCCCGCCACGTACGACCTCGTCCTCGTCCTGACG
GGTCCCGACGGCGCGCGTCGGCCCGAGGCCCTCGATCTACTCAGTCGCCACGTCTATGCTTTGCTGGTCCCGTCT
ATGAAGTCTGGTGGGAGTCTGCGCTTTCAACACGGCGCTCCGCTACCCGGAGACGCCAAGGAGGCTATCTTGGCT
GGCTTAGTTGAGGCGGGTGACGTGTTCGAGAAGCCTGCCGATGAAGAAGCGGTTGTGCCGTTGCGGCTTGGGAAG
AAGGGTAAGGATCCGCCGGCGACGTCCAAGTTCGACTTTAGCCAGCTCAACGGCGACGACGACGACGACGACGAC
TTGGTGGATGAAAACGACCTGCTCTCGGAAGAAGACCGCAAGAGACGGCCCACCATACCCGTCAACTGCCAGCCT
GAGAAGCGCAGACGCCCTTGCAAGGACTGTACGTGTGGCCTCGCCGCCAAATTCGAGGCCGAAGACCGTGAGCGA
CGGGCCAAAGCCACCCAGGGCCTCGAAGCGCTTAAGCTCGACGCCAACGACCTCAACGAGCTCGATTTCACCGTC
AAGGGCAAGACAGGCTCGTGCAACAATTGCTCGCTCGGCGACGCTTTCCGCTGCTCGACCTGTCCGTACATTGGC
CTGCCGGCATTTAAGCCTGGGGAGGAGGTACGGATCTTGAATGACGTGGTGCAGCTGTGA
Gene >Ophio5|7136
ATGGCCCCCTCGCCCGCCAACGACGCCATCGCCGCGTCCACCAAACCCGCCACTGGCCGCACCCTACTTCTCGCC
CCTCCCTCACTCGCCGCCCATCAGGACAAGCTACAAGATGTCTTTGCATCTCTGGACCGCGCAACCTGCGACATG
CACATGCTCGACCGCCTCTCCGCCGGGCTCGTCGCCCTGCCGCCCGCCACGTACGACCTCGTCCTCGTCCTGACG
GGTCCCGACGGCGCGCGTCGGCCCGAGGCCCTCGATCTACTCAGTCGCCACGTCTATGCTTTGCTGGTCCCGTCT
ATGAAGTCTGGTGGGAGTCTGCGCTTTCAACACGGCGCTCCGCTACCCGGAGACGCCAAGGAGGCTATCTTGGCT
GGCTTAGTTGAGGCGGGTGACGTGTTCGAGAAGCCTGCCGATGAAGAAGCGGTTGTGCCGTTGCGGCTTGGGAAG
AAGGGTAAGGATCCGCCGGCGACGTCCAAGTTCGACTTTAGCCAGCTCAACGGCGACGACGACGACGACGACGAC
TTGGTGGATGAAAACGACCTGCTCTCGGAAGAAGACCGCAAGAGACGGCCCACCATACGTTGGTCCTCCTCCCCT
CCCTTTTCAAACACGTGACTAATCTTTAACTCCAACAGCCGTCAACTGCCAGCCTGAGAAGCGCAGACGCCCTTG
CAAGGACTGTACGTGTGGCCTCGCCGCCAAATTCGAGGCCGAAGACCGTGAGCGACGGGCCAAAGCCACCCAGGG
CCTCGAAGCGCTTAAGCTCGACGCCAACGACCTCAACGAGCTCGATTTCACCGTCAAGGGCAAGACAGGCTCGTG
CAACAATTGCTCGCTCGGCGACGCTTTCCGCTGCTCGACCTGTCCGTACATTGGCCTGCCGGCATTTAAGCCTGG
GGAGGAGGTACGGATCTTGAATGACGTGGTGCAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail