Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7129
Gene name
Locationscaffold_667:6526..7979
Strand+
Gene length (bp)1453
Transcript length (bp)1398
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.1E-65 178 429
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 5.4E-08 4 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 2 459 1.0E-107
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 3 439 3.0E-104
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 2 439 2.0E-76
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 2 439 4.0E-76
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 2 444 7.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 2 459 1.0E-107
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 3 439 3.0E-104
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 2 439 2.0E-76
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 2 439 4.0E-76
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 2 444 7.0E-76
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 2 438 7.0E-76
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 2 446 2.0E-75
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 2 438 4.0E-75
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 2 438 5.0E-75
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 2 429 2.0E-74
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 3 440 3.0E-74
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 3 453 2.0E-73
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 2 432 3.0E-73
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 3 362 9.0E-73
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 2 446 9.0E-73
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 3 330 1.0E-72
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 2 443 2.0E-72
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 2 451 4.0E-72
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 2 450 7.0E-72
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 2 332 1.0E-71
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 2 337 2.0E-71
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 2 415 5.0E-71
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 2 332 5.0E-71
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 2 406 1.0E-70
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 2 332 1.0E-70
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 2 440 1.0E-69
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 2 413 3.0E-69
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 2 406 2.0E-68
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 2 376 2.0E-66
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 2 438 7.0E-66
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 2 440 2.0E-65
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 2 428 3.0E-65
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 2 338 2.0E-64
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 2 428 2.0E-64
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 2 450 9.0E-64
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 2 428 1.0E-63
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 2 435 5.0E-63
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 4 441 3.0E-62
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 2 438 7.0E-62
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 2 444 1.0E-61
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 2 432 3.0E-61
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 2 436 3.0E-61
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 2 428 7.0E-61
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 2 432 5.0E-58
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 3 432 3.0E-57
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 2 344 8.0E-54
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 108 385 1.0E-52
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 2 344 1.0E-50
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 2 320 3.0E-49
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 2 314 5.0E-49
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 2 314 1.0E-48
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 2 314 2.0E-48
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 2 436 3.0E-48
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 2 314 3.0E-47
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 1 307 2.0E-45
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 1 307 3.0E-45
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 2 308 4.0E-41
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 2 111 2.0E-13
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 2 174 5.0E-11
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 2 174 1.0E-10
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 2 174 6.0E-10
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 2 174 3.0E-09
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 2 174 3.0E-09
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 2 178 4.0E-09
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 2 268 4.0E-09
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 3 173 4.0E-09
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 3 173 5.0E-09
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 2 173 6.0E-09
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 3 173 7.0E-09
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 2 173 1.0E-08
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 3 173 1.0E-08
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 3 173 1.0E-08
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 3 173 2.0E-08
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 5 178 2.0E-08
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 3 173 2.0E-08
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 2 210 2.0E-08
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 2 178 2.0E-08
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 2 178 2.0E-08
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 2 173 2.0E-08
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 3 322 3.0E-08
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 2 173 3.0E-08
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 2 173 3.0E-08
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 2 173 3.0E-08
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 2 222 4.0E-08
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 2 178 4.0E-08
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 2 173 6.0E-08
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 2 173 6.0E-08
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 2 173 7.0E-08
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 2 173 8.0E-08
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 3 173 8.0E-08
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 2 173 1.0E-07
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 2 173 1.0E-07
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 2 173 1.0E-07
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 3 173 1.0E-07
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 2 173 2.0E-07
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 2 173 2.0E-07
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 2 178 3.0E-07
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 3 173 3.0E-07
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 2 173 4.0E-07
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 2 173 4.0E-07
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 2 173 5.0E-07
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 2 210 8.0E-07
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 2 173 1.0E-06
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 2 211 1.0E-06
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 2 211 2.0E-06
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 2 173 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 239 261 22
2 292 314 22
3 324 346 22
4 358 380 22
5 400 419 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7129
MDLELVGATAIEDKLQVGVAETIETLREANIKVWMLTGDKRETAINIGHAAGLCKPSSDVFVLDGPASLTASLRD
ARPGPATAPTVAVLDGRTLSALVDGDWSDEATQKQFSELVSRVDSIICCRAAPSQKAALVETVRRHQQESMTLAI
GDGANDIGMIQAAHIGIGISGREGLQAARVSDYAIAQFRFLSRLLLVHGRWNYLRASRFILASFWKEFLLIITQA
HYQRLTGFTAASLFEGWSMMFFNSVMTSLAVLVPGVMDRDLSPRTLLAKPELYAIGQKGQAFNLRLYLGWSAMGV
VGSFIVFYIVLGAFGRGMVEEDGSIFAFGHASFTVCVVFINVKLLILECHAKTMVTFFAFVLTMGAWFTMMAGLC
AAYVGKIGPKPIRHALTVTFGPSLRWWMTVVAAFTTLLVLELTVQTLRRVYFPSDVDREQRLEKVEAAALRDEEK
EEGGGLLGAFWEGRI
Coding >Ophio5|7129
ATGGACCTTGAATTGGTGGGCGCGACGGCCATCGAAGACAAGTTGCAGGTCGGCGTGGCGGAAACAATCGAGACG
CTGCGGGAGGCCAATATCAAGGTCTGGATGCTGACGGGCGACAAGCGCGAGACGGCCATCAACATCGGACACGCG
GCGGGTCTGTGCAAGCCGTCTTCGGACGTGTTTGTCCTCGATGGGCCGGCCTCTCTGACGGCCTCTCTCCGGGAT
GCTCGGCCCGGTCCGGCGACGGCGCCGACGGTGGCGGTGCTCGACGGCCGGACGCTCTCGGCGCTCGTGGACGGT
GACTGGAGTGACGAGGCTACCCAGAAGCAGTTCAGCGAGCTCGTCAGCCGCGTCGACTCCATCATCTGCTGCCGG
GCCGCGCCCTCGCAAAAGGCAGCCCTTGTCGAGACGGTCCGGCGGCACCAGCAAGAGAGCATGACGCTCGCCATC
GGCGACGGCGCAAACGATATTGGTATGATACAGGCGGCGCACATTGGTATCGGCATCTCGGGCCGCGAGGGACTA
CAGGCCGCTCGCGTGTCAGACTACGCCATCGCCCAGTTCCGCTTCCTATCCCGACTACTGCTCGTCCACGGCCGG
TGGAACTACCTCCGGGCGAGTCGATTCATCCTCGCCTCCTTCTGGAAGGAGTTTCTCCTCATAATCACGCAGGCG
CACTACCAGCGCCTGACTGGCTTCACGGCTGCGTCGCTGTTCGAAGGCTGGAGCATGATGTTCTTCAACAGCGTC
ATGACGTCGCTGGCCGTCCTCGTCCCCGGCGTCATGGACCGCGATCTTAGTCCCCGGACGCTGCTTGCCAAGCCT
GAGCTGTACGCCATCGGACAGAAGGGACAGGCCTTCAACCTCAGGCTGTATTTGGGCTGGTCGGCCATGGGTGTG
GTGGGCAGCTTCATCGTGTTTTATATCGTGCTCGGGGCATTCGGTAGGGGGATGGTGGAGGAGGATGGGAGCATT
TTCGCTTTTGGACACGCGAGCTTCACCGTCTGCGTTGTTTTTATCAACGTGAAGCTGCTCATCCTCGAATGCCAC
GCCAAAACCATGGTCACCTTTTTCGCCTTTGTCCTCACCATGGGCGCCTGGTTCACGATGATGGCCGGCTTGTGC
GCCGCCTACGTCGGCAAGATCGGGCCAAAACCGATACGACACGCGCTGACGGTTACCTTTGGCCCGAGTCTGCGT
TGGTGGATGACGGTGGTGGCGGCTTTTACCACGTTATTGGTGCTAGAACTCACGGTGCAGACGCTGCGGCGCGTG
TATTTCCCGTCGGATGTGGATCGCGAGCAGAGGCTGGAGAAGGTCGAGGCGGCGGCGTTGAGGGACGAGGAGAAG
GAGGAGGGCGGTGGGTTGCTAGGGGCGTTTTGGGAGGGGAGGATA
Transcript >Ophio5|7129
ATGGACCTTGAATTGGTGGGCGCGACGGCCATCGAAGACAAGTTGCAGGTCGGCGTGGCGGAAACAATCGAGACG
CTGCGGGAGGCCAATATCAAGGTCTGGATGCTGACGGGCGACAAGCGCGAGACGGCCATCAACATCGGACACGCG
GCGGGTCTGTGCAAGCCGTCTTCGGACGTGTTTGTCCTCGATGGGCCGGCCTCTCTGACGGCCTCTCTCCGGGAT
GCTCGGCCCGGTCCGGCGACGGCGCCGACGGTGGCGGTGCTCGACGGCCGGACGCTCTCGGCGCTCGTGGACGGT
GACTGGAGTGACGAGGCTACCCAGAAGCAGTTCAGCGAGCTCGTCAGCCGCGTCGACTCCATCATCTGCTGCCGG
GCCGCGCCCTCGCAAAAGGCAGCCCTTGTCGAGACGGTCCGGCGGCACCAGCAAGAGAGCATGACGCTCGCCATC
GGCGACGGCGCAAACGATATTGGTATGATACAGGCGGCGCACATTGGTATCGGCATCTCGGGCCGCGAGGGACTA
CAGGCCGCTCGCGTGTCAGACTACGCCATCGCCCAGTTCCGCTTCCTATCCCGACTACTGCTCGTCCACGGCCGG
TGGAACTACCTCCGGGCGAGTCGATTCATCCTCGCCTCCTTCTGGAAGGAGTTTCTCCTCATAATCACGCAGGCG
CACTACCAGCGCCTGACTGGCTTCACGGCTGCGTCGCTGTTCGAAGGCTGGAGCATGATGTTCTTCAACAGCGTC
ATGACGTCGCTGGCCGTCCTCGTCCCCGGCGTCATGGACCGCGATCTTAGTCCCCGGACGCTGCTTGCCAAGCCT
GAGCTGTACGCCATCGGACAGAAGGGACAGGCCTTCAACCTCAGGCTGTATTTGGGCTGGTCGGCCATGGGTGTG
GTGGGCAGCTTCATCGTGTTTTATATCGTGCTCGGGGCATTCGGTAGGGGGATGGTGGAGGAGGATGGGAGCATT
TTCGCTTTTGGACACGCGAGCTTCACCGTCTGCGTTGTTTTTATCAACGTGAAGCTGCTCATCCTCGAATGCCAC
GCCAAAACCATGGTCACCTTTTTCGCCTTTGTCCTCACCATGGGCGCCTGGTTCACGATGATGGCCGGCTTGTGC
GCCGCCTACGTCGGCAAGATCGGGCCAAAACCGATACGACACGCGCTGACGGTTACCTTTGGCCCGAGTCTGCGT
TGGTGGATGACGGTGGTGGCGGCTTTTACCACGTTATTGGTGCTAGAACTCACGGTGCAGACGCTGCGGCGCGTG
TATTTCCCGTCGGATGTGGATCGCGAGCAGAGGCTGGAGAAGGTCGAGGCGGCGGCGTTGAGGGACGAGGAGAAG
GAGGAGGGCGGTGGGTTGCTAGGGGCGTTTTGGGAGGGGAGGATATGA
Gene >Ophio5|7129
ATGGACCTTGAATTGGTGGGCGCGACGGCCATCGAAGACAAGTTGCAGGTCGGCGTGGCGGAAACAATCGAGACG
CTGCGGGAGGCCAATATCAAGGTCTGGATGCTGACGGGCGACAAGCGCGAGACGGCCATCAACATCGGACACGCG
GCGGGTCTGTGCAAGCCGTCTTCGGACGTGTTTGTCCTCGATGGGCCGGCCTCTCTGACGGCCTCTCTCCGGGAT
GCTCGGCCCGGTCCGGCGACGGCGCCGACGGTGGCGGTGCTCGACGGCCGGACGCTCTCGGCGCTCGTGGACGGT
GACTGGAGTGACGAGGCTACCCAGAAGCAGTTCAGCGAGCTCGTCAGCCGCGTCGACTCCATCATCTGCTGCCGG
GCCGCGCCCTCGCAAAAGGCAGCCCTTGTCGAGACGGTCCGGCGGCACCAGCAAGAGAGCATGACGCTCGCCATC
GGCGACGGCGCAAACGATATTGGTATGATACAGGCGGCGCACATTGGTATCGGCATCTCGGGCCGCGAGGGACTA
CAGGCCGCTCGCGTGTCAGACTACGCCATCGCCCAGTTCCGCTTCCTATCCCGACTACTGCTCGTCCACGGCCGG
TGGAACTACCTCCGGGCGAGTCGATTCATCCTCGCCTCCTTCTGGAAGGAGTTTCTCCTCATAATCACGCAGGCG
CACTACCAGCGCCTGACTGGCTTCACGGCTGCGTCGCTGTTCGAAGGCTGGAGCATGATGTTCTTCAACAGCGTC
ATGACGTCGCTGGCCGTCCTCGTCCCCGGCGTCATGGACCGCGATCTTAGTCCCCGGACGCTGCTTGCCAAGCCT
GAGCTGTACGCCATCGGACAGAAGGGACAGGCCTTCAACCTCAGGCTGTATTTGGGCTGGTCGGCCATGGGTGTG
GTGGGCAGCTTCATCGTGTTTTATATCGTGCTCGGGGCATTCGGTAGGGGGATGGTGGAGGAGGATGGGAGCATT
TTCGCTTTTGGACACGCGAGCTTCACCGTCTGCGTTGTTTTTATCAACGTGAAGCTGCTGTCCGCCCCCTTTCTT
TCTCTCTTTCTTTTTCGGTCTTCCGCTAACGAGGCACAGCATCCTCGAATGCCACGCCAAAACCATGGTCACCTT
TTTCGCCTTTGTCCTCACCATGGGCGCCTGGTTCACGATGATGGCCGGCTTGTGCGCCGCCTACGTCGGCAAGAT
CGGGCCAAAACCGATACGACACGCGCTGACGGTTACCTTTGGCCCGAGTCTGCGTTGGTGGATGACGGTGGTGGC
GGCTTTTACCACGTTATTGGTGCTAGAACTCACGGTGCAGACGCTGCGGCGCGTGTATTTCCCGTCGGATGTGGA
TCGCGAGCAGAGGCTGGAGAAGGTCGAGGCGGCGGCGTTGAGGGACGAGGAGAAGGAGGAGGGCGGTGGGTTGCT
AGGGGCGTTTTGGGAGGGGAGGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail