Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7126
Gene name
Locationscaffold_666:8626..9877
Strand-
Gene length (bp)1251
Transcript length (bp)1251
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 2.2E-28 140 349
PF19055 ABC2_membrane_7 ABC-2 type transporter 1.4E-10 20 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 1 416 2.0E-42
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 2 382 4.0E-38
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 1 416 3.0E-37
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 4 416 3.0E-35
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 4 353 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 1 416 2.0E-42
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 2 382 4.0E-38
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 1 416 3.0E-37
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 4 416 3.0E-35
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 4 353 3.0E-34
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 4 415 3.0E-32
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 4 370 5.0E-31
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 4 412 2.0E-30
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 1 415 2.0E-29
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 4 380 5.0E-29
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 4 415 8.0E-29
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 4 370 7.0E-28
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 4 380 1.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 1 414 3.0E-27
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 4 370 2.0E-26
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 1 381 9.0E-26
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 1 397 1.0E-25
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 4 354 2.0E-25
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 13 399 5.0E-25
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 4 415 6.0E-25
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 4 357 2.0E-24
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 1 356 4.0E-24
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 4 415 1.0E-23
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 4 351 3.0E-23
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 4 349 4.0E-23
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 4 323 1.0E-22
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 4 359 2.0E-22
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 4 354 2.0E-22
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 1 416 5.0E-22
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 4 386 5.0E-22
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 4 357 1.0E-21
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 1 416 2.0E-21
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 4 359 2.0E-21
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 14 369 3.0E-21
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 14 369 4.0E-21
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 21 356 5.0E-21
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 21 356 7.0E-21
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 4 357 8.0E-21
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 4 351 8.0E-21
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 4 415 1.0E-20
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 4 385 1.0E-20
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 1 356 3.0E-20
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 4 356 4.0E-20
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 4 412 5.0E-20
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 13 399 8.0E-20
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 4 371 1.0E-19
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 4 371 5.0E-19
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 16 358 8.0E-19
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 4 362 9.0E-19
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 1 408 2.0E-18
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 1 384 3.0E-18
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 4 384 9.0E-18
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 10 361 2.0E-17
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 4 359 2.0E-17
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 4 350 2.0E-17
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 16 358 2.0E-17
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 16 358 2.0E-17
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 4 359 2.0E-17
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 16 355 3.0E-17
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 4 358 6.0E-17
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 15 329 1.0E-16
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 121 415 1.0E-16
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 15 350 1.0E-16
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 4 359 1.0E-16
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 4 415 1.0E-16
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 16 355 2.0E-16
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 4 356 3.0E-16
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 1 413 3.0E-16
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 16 355 4.0E-16
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 4 345 5.0E-16
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 15 415 5.0E-16
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 4 352 5.0E-16
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 15 415 5.0E-16
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 16 356 5.0E-16
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1 356 7.0E-16
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 4 292 9.0E-16
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 4 356 9.0E-16
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 15 391 1.0E-15
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 4 365 2.0E-15
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 4 356 2.0E-15
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 1 413 2.0E-15
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 4 359 2.0E-15
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 4 331 2.0E-15
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 16 366 2.0E-15
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 4 331 2.0E-15
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 16 366 4.0E-15
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 4 349 4.0E-15
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 16 358 5.0E-15
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 15 334 5.0E-15
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 1 354 5.0E-15
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 16 355 6.0E-15
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 16 385 7.0E-15
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 4 356 8.0E-15
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 16 356 9.0E-15
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 4 356 1.0E-14
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 16 356 1.0E-14
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 15 391 1.0E-14
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 4 373 1.0E-14
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 4 334 1.0E-14
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 161 356 2.0E-14
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 4 354 2.0E-14
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 15 337 2.0E-14
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 4 359 2.0E-14
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 4 345 3.0E-14
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 16 354 3.0E-14
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 4 331 4.0E-14
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 16 402 4.0E-14
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 4 358 8.0E-14
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 1 355 8.0E-14
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 15 329 1.0E-13
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 15 329 1.0E-13
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 1 398 2.0E-13
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 1 415 2.0E-13
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 1 334 3.0E-13
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 4 277 3.0E-13
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 15 329 3.0E-13
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 4 331 4.0E-13
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 4 399 6.0E-13
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 4 415 7.0E-13
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 15 334 1.0E-12
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 18 358 1.0E-12
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 16 397 1.0E-12
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 4 331 1.0E-12
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 16 356 1.0E-12
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 1 353 2.0E-12
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 1 391 2.0E-12
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 1 334 2.0E-12
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 1 349 2.0E-12
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 15 399 3.0E-12
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 4 332 3.0E-12
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 15 348 7.0E-12
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 15 262 7.0E-12
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 1 319 1.0E-11
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 15 334 1.0E-11
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 1 366 1.0E-11
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 15 329 1.0E-11
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 1 331 1.0E-11
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 16 356 2.0E-11
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 15 334 2.0E-11
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 15 334 4.0E-11
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 4 356 4.0E-11
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 19 351 4.0E-11
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 4 331 5.0E-11
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 16 356 6.0E-11
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 16 404 7.0E-11
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 12 356 8.0E-11
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 15 329 1.0E-10
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 16 355 1.0E-10
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 15 320 2.0E-10
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 16 355 2.0E-10
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 16 384 3.0E-10
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 4 331 3.0E-10
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 16 355 3.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 143 359 4.0E-10
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 15 334 5.0E-10
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 15 334 5.0E-10
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 1 329 6.0E-10
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 1 78 7.0E-10
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 16 356 7.0E-10
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 1 349 2.0E-09
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 15 323 2.0E-09
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 4 372 3.0E-09
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 15 318 3.0E-09
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 15 265 1.0E-08
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 15 351 1.0E-08
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 15 384 1.0E-08
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 4 372 2.0E-08
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 4 372 2.0E-08
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 4 349 2.0E-08
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 15 334 4.0E-08
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 4 218 4.0E-08
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 1 295 6.0E-08
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 15 329 7.0E-08
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 15 399 8.0E-08
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 1 351 8.0E-08
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 16 355 1.0E-07
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 15 351 1.0E-07
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 4 310 1.0E-07
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 1 295 2.0E-07
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 1 351 4.0E-07
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 4 146 4.0E-07
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 4 356 5.0E-07
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 1 356 5.0E-07
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 15 351 7.0E-07
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 15 334 2.0E-06
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 4 358 2.0E-06
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 141 296 2.0E-06
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 4 267 3.0E-06
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1 75 3.0E-06
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 15 323 6.0E-06
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 4 384 8.0E-06
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 4 115 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 155 177 22
2 192 211 19
3 232 254 22
4 267 289 22
5 296 318 22
6 390 412 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7126
MHHLRKLAKRDKLIIICSIHQPSTTTFNLLDKVLLLSEGKTHYFGPVRDITSYYEAIHLPIPQRVNPAEFLLEMT
NVEFAHDKLSAGRRLADLHDTWKSSTLADELRASIGALSKLDACDDNNALFDSVEVMMPGLASRTWILVRRSITK
SYRDVFAYGIRLAMYMGLALMMGTVWLRLEPVQASIQPYINAIFFGSAFMSFMAVAYVPAFLEDHGLFVKDYRNG
LYGPAELVLSNFLVGVPYLFAISLIFSLITYWLSNFQPSATAFFTWVMWLFLDLLAAESLVVLVSSLIPNFVASL
AVVAFMNGLWMSVGGFMLSPTSLNVFYKYAFHYWDYQKYVFESMMINEFANRSYDCGRNCHCMYESSLADQCKIS
GRAVLEQYGYETGGMGQRVAILVAIILGHRLAAWAVLRWRN
Coding >Ophio5|7126
ATGCATCACCTACGCAAGCTAGCCAAGCGCGACAAGCTCATCATCATCTGTTCCATCCACCAACCTTCGACGACG
ACCTTTAACCTCCTCGATAAAGTACTTTTACTATCGGAGGGAAAGACGCATTATTTCGGACCGGTTCGGGACATT
ACCTCGTATTACGAAGCCATTCATCTTCCTATACCGCAACGCGTCAACCCGGCTGAGTTTCTATTGGAGATGACG
AATGTCGAGTTCGCGCACGATAAGCTCTCGGCTGGACGTCGTCTGGCCGACCTTCATGATACGTGGAAGTCATCG
ACTTTGGCCGACGAGCTGCGAGCTTCCATTGGCGCCCTCTCCAAGTTGGACGCATGTGACGACAACAACGCCCTG
TTCGATTCGGTCGAGGTGATGATGCCTGGTCTGGCCAGTCGGACTTGGATCCTCGTCCGAAGAAGCATCACCAAG
AGTTATCGTGACGTCTTCGCCTATGGCATTCGTCTGGCCATGTACATGGGTCTGGCCCTCATGATGGGCACCGTC
TGGCTACGACTGGAGCCTGTTCAGGCCTCCATTCAACCGTACATCAATGCCATCTTCTTCGGCTCCGCCTTCATG
TCCTTTATGGCCGTGGCCTACGTCCCGGCCTTTCTCGAGGACCACGGGCTCTTCGTCAAGGATTATCGAAACGGT
CTCTACGGTCCGGCCGAGCTGGTCTTGTCGAATTTCCTCGTCGGCGTGCCCTATCTTTTCGCCATCTCCCTCATC
TTCTCCCTCATCACCTATTGGCTATCCAACTTCCAGCCCAGCGCCACCGCCTTCTTTACCTGGGTCATGTGGCTC
TTTCTCGACCTGCTGGCGGCCGAATCCCTCGTCGTCTTGGTATCCTCTCTGATTCCCAACTTTGTGGCCTCGCTG
GCCGTCGTCGCCTTCATGAACGGTCTCTGGATGTCCGTCGGTGGCTTCATGCTGTCCCCCACCAGCCTCAACGTC
TTTTACAAATACGCCTTTCACTACTGGGACTACCAAAAGTACGTCTTCGAATCCATGATGATCAACGAGTTTGCC
AACCGGTCCTACGACTGCGGCCGCAACTGCCACTGCATGTACGAATCCTCTCTGGCCGACCAGTGTAAGATTTCC
GGCCGCGCCGTGTTGGAGCAGTATGGCTATGAGACGGGCGGGATGGGACAACGGGTGGCCATCCTGGTGGCTATC
ATCCTCGGCCATCGACTGGCTGCCTGGGCCGTGCTCCGATGGAGGAAT
Transcript >Ophio5|7126
ATGCATCACCTACGCAAGCTAGCCAAGCGCGACAAGCTCATCATCATCTGTTCCATCCACCAACCTTCGACGACG
ACCTTTAACCTCCTCGATAAAGTACTTTTACTATCGGAGGGAAAGACGCATTATTTCGGACCGGTTCGGGACATT
ACCTCGTATTACGAAGCCATTCATCTTCCTATACCGCAACGCGTCAACCCGGCTGAGTTTCTATTGGAGATGACG
AATGTCGAGTTCGCGCACGATAAGCTCTCGGCTGGACGTCGTCTGGCCGACCTTCATGATACGTGGAAGTCATCG
ACTTTGGCCGACGAGCTGCGAGCTTCCATTGGCGCCCTCTCCAAGTTGGACGCATGTGACGACAACAACGCCCTG
TTCGATTCGGTCGAGGTGATGATGCCTGGTCTGGCCAGTCGGACTTGGATCCTCGTCCGAAGAAGCATCACCAAG
AGTTATCGTGACGTCTTCGCCTATGGCATTCGTCTGGCCATGTACATGGGTCTGGCCCTCATGATGGGCACCGTC
TGGCTACGACTGGAGCCTGTTCAGGCCTCCATTCAACCGTACATCAATGCCATCTTCTTCGGCTCCGCCTTCATG
TCCTTTATGGCCGTGGCCTACGTCCCGGCCTTTCTCGAGGACCACGGGCTCTTCGTCAAGGATTATCGAAACGGT
CTCTACGGTCCGGCCGAGCTGGTCTTGTCGAATTTCCTCGTCGGCGTGCCCTATCTTTTCGCCATCTCCCTCATC
TTCTCCCTCATCACCTATTGGCTATCCAACTTCCAGCCCAGCGCCACCGCCTTCTTTACCTGGGTCATGTGGCTC
TTTCTCGACCTGCTGGCGGCCGAATCCCTCGTCGTCTTGGTATCCTCTCTGATTCCCAACTTTGTGGCCTCGCTG
GCCGTCGTCGCCTTCATGAACGGTCTCTGGATGTCCGTCGGTGGCTTCATGCTGTCCCCCACCAGCCTCAACGTC
TTTTACAAATACGCCTTTCACTACTGGGACTACCAAAAGTACGTCTTCGAATCCATGATGATCAACGAGTTTGCC
AACCGGTCCTACGACTGCGGCCGCAACTGCCACTGCATGTACGAATCCTCTCTGGCCGACCAGTGTAAGATTTCC
GGCCGCGCCGTGTTGGAGCAGTATGGCTATGAGACGGGCGGGATGGGACAACGGGTGGCCATCCTGGTGGCTATC
ATCCTCGGCCATCGACTGGCTGCCTGGGCCGTGCTCCGATGGAGGAATTGA
Gene >Ophio5|7126
ATGCATCACCTACGCAAGCTAGCCAAGCGCGACAAGCTCATCATCATCTGTTCCATCCACCAACCTTCGACGACG
ACCTTTAACCTCCTCGATAAAGTACTTTTACTATCGGAGGGAAAGACGCATTATTTCGGACCGGTTCGGGACATT
ACCTCGTATTACGAAGCCATTCATCTTCCTATACCGCAACGCGTCAACCCGGCTGAGTTTCTATTGGAGATGACG
AATGTCGAGTTCGCGCACGATAAGCTCTCGGCTGGACGTCGTCTGGCCGACCTTCATGATACGTGGAAGTCATCG
ACTTTGGCCGACGAGCTGCGAGCTTCCATTGGCGCCCTCTCCAAGTTGGACGCATGTGACGACAACAACGCCCTG
TTCGATTCGGTCGAGGTGATGATGCCTGGTCTGGCCAGTCGGACTTGGATCCTCGTCCGAAGAAGCATCACCAAG
AGTTATCGTGACGTCTTCGCCTATGGCATTCGTCTGGCCATGTACATGGGTCTGGCCCTCATGATGGGCACCGTC
TGGCTACGACTGGAGCCTGTTCAGGCCTCCATTCAACCGTACATCAATGCCATCTTCTTCGGCTCCGCCTTCATG
TCCTTTATGGCCGTGGCCTACGTCCCGGCCTTTCTCGAGGACCACGGGCTCTTCGTCAAGGATTATCGAAACGGT
CTCTACGGTCCGGCCGAGCTGGTCTTGTCGAATTTCCTCGTCGGCGTGCCCTATCTTTTCGCCATCTCCCTCATC
TTCTCCCTCATCACCTATTGGCTATCCAACTTCCAGCCCAGCGCCACCGCCTTCTTTACCTGGGTCATGTGGCTC
TTTCTCGACCTGCTGGCGGCCGAATCCCTCGTCGTCTTGGTATCCTCTCTGATTCCCAACTTTGTGGCCTCGCTG
GCCGTCGTCGCCTTCATGAACGGTCTCTGGATGTCCGTCGGTGGCTTCATGCTGTCCCCCACCAGCCTCAACGTC
TTTTACAAATACGCCTTTCACTACTGGGACTACCAAAAGTACGTCTTCGAATCCATGATGATCAACGAGTTTGCC
AACCGGTCCTACGACTGCGGCCGCAACTGCCACTGCATGTACGAATCCTCTCTGGCCGACCAGTGTAAGATTTCC
GGCCGCGCCGTGTTGGAGCAGTATGGCTATGAGACGGGCGGGATGGGACAACGGGTGGCCATCCTGGTGGCTATC
ATCCTCGGCCATCGACTGGCTGCCTGGGCCGTGCTCCGATGGAGGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail