Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|712
Gene name
Locationscaffold_12:3267..6896
Strand-
Gene length (bp)3629
Transcript length (bp)3336
Coding sequence length (bp)3333
Protein length (aa) 1111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.2E-28 76 399
PF07993 NAD_binding_4 Male sterility protein 1.1E-26 746 983
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-09 744 985
PF00550 PP-binding Phosphopantetheine attachment site 7.8E-06 623 684

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 450 1089 1.0E-14
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 642 963 3.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 743 963 2.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 728 1051 5.0E-08
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 634 1060 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 450 1089 1.0E-14
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 642 963 3.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 743 963 2.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 728 1051 5.0E-08
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 634 1060 9.0E-08
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 38 660 3.0E-07
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 733 1039 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|712
MAAFFYNKFAAPFRRPGDIWAVSKTMLAPQVNLGPQSGLDPALRRHRATSDLSSRGQSPANRYGHRLLVDVVEGT
AKRDPTRAFVHHPKTSNPADGFVQVTYREAVNAINHLAHLITKELGVPAKNSFPTICYIGSQDIRYIFFLVACVK
AGYKALFNSPRNSLEAALSLLQATDCHALFYAESQQKTVEPWLQNRQMKHFVIDATDNLLASEPEPFPYSKTFEE
AVWDPVVVLHTSGSTGIPKPIVVRQGSLAVADAYRNLPEIGGARFFFDEYKKRTNLYFRHMPLFHAASVYGFLCG
HIFYGIPMAFGCPDSPLTAEHVMECIKYSGSDSCMLPPSVLEEVANSAEGLALLEKMSFVTFGGGPVAPAIGNAL
AQRGILLQSAIGSTEQYPYAMYFQPKPANWQYFIFNADAMGGDFRPIDGPGSPEELVIVRKGHGQLPSQSVFFTF
PDKTEWSTNDIFMPHPELPSHWTYKGRIDNIIVFSNGEKLNPATIEDTINGLPKIKGAMVVGQGRFQPALILEPC
VSPKSDEEAAELINEVWPVIELVNKETVAHGRISKDFIGLSRPDAPFPRSAKGSLQRALAMEMYNDDIDVLYERA
LSGEAGGPVTLDLSSEKALANSIVQLVDSRIGVSGLAPETDYFDAGIDSAQVIRIASMLRAGLKHVPLPNVDLQE
AVSPKQIYANNSSQMLAGYLLSLVSGESASGQEQAREMKVMEELLAKYTQNLPGPAAGKPKPNDEGQTVVLTGTT
GSLGAYMLDMLCASPRVKKIVAMNRGADGGRSRQAGVSSDRGLGTDFSKVQFVGVDVSKPSLGMEEKEYEQVLSE
VDRVIHNAWSVNFNLNVRSFEPQIRGVRHLVDMVAAAAKQAPIAFLSSVGSVGGWQHKELAVPEHTFEDLSMPVM
GYGRSKALGSLILDAAAAQSGLHTAVVRVGQVGGPRGEKGCWNKPEYFPSLVASGLHLGVLPNDLGPRQRVDWLT
MEEVASTILEIVGATTQVKVDDISGYYHASNPNEASWPDMAQAIKDYYGGRIKNLVSLEEWQDILEKSAAAEDAD
LELNPSIKLLESHRDVIKGKRAGIKPTVLATERTIKVSPTMRASKAITPSMMQHWCKQWHY
Coding >Ophio5|712
ATGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTCCGTCGACCGGGAGACATTTGGGCAGTCTCAAAAACC
ATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCCGGCTCTGAGGCGCCACCGCGCGACGTCA
GACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCGGCTTCTTGTCGACGTGGTCGAGGGGACG
GCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTCCAACCCTGCGGATGGTTTCGTCCAGGTG
ACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCATCACCAAGGAGCTGGGTGTGCCGGCCAAG
AACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTACATCTTCTTCTTGGTTGCCTGTGTCAAG
GCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGCCGCCCTCTCTCTTCTCCAGGCCACCGAC
TGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCCTTGGCTTCAGAACCGGCAGATGAAGCAC
TTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCCTTTCCCCTACAGCAAGACGTTTGAGGAG
GCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGGCATTCCAAAGCCCATCGTCGTCCGGCAG
GGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGGCGGGGCGAGGTTCTTCTTCGACGAGTAC
AAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGCGGCCTCCGTTTACGGCTTCCTTTGCGGC
CATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCCGTTGACGGCGGAGCATGTCATGGAGTGC
ATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCTTGAGGAGGTGGCCAATTCGGCCGAGGGC
CTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTCCCGTGGCTCCAGCAATCGGCAATGCGCTG
GCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGCAATACCCGTACGCCATGTACTTTCAGCCT
AAACCTGCCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCC
GGCAGCCCCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTC
CCCGACAAGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAG
GGCCGTATCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAAC
GGTCTGCCTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGC
GTCAGCCCCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAG
GAGACTGTTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCG
GCCAAGGGCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCC
TTGTCCGGCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAG
CTCGTGGACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCC
CAGGTGATTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAG
GCCGTCTCGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCT
GGCGAGTCGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAA
AACCTTCCTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACT
GGCTCGCTGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGC
GGCGCAGACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTG
CAGTTCGTCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAG
GTGGACCGCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGA
GGCGTCCGCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGC
TCCGTCGGTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATG
GGATACGGCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCC
GTGGTGCGTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGT
CTGGTCGCCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACG
ATGGAGGAGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGC
TACTACCACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGC
AGGATCAAGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGAC
CTGGAGCTCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAG
CCGACGGTGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGC
ATGATGCAGCACTGGTGCAAGCAGTGGCACTAT
Transcript >Ophio5|712
ATGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTCCGTCGACCGGGAGACATTTGGGCAGTCTCAAAAACC
ATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCCGGCTCTGAGGCGCCACCGCGCGACGTCA
GACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCGGCTTCTTGTCGACGTGGTCGAGGGGACG
GCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTCCAACCCTGCGGATGGTTTCGTCCAGGTG
ACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCATCACCAAGGAGCTGGGTGTGCCGGCCAAG
AACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTACATCTTCTTCTTGGTTGCCTGTGTCAAG
GCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGCCGCCCTCTCTCTTCTCCAGGCCACCGAC
TGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCCTTGGCTTCAGAACCGGCAGATGAAGCAC
TTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCCTTTCCCCTACAGCAAGACGTTTGAGGAG
GCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGGCATTCCAAAGCCCATCGTCGTCCGGCAG
GGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGGCGGGGCGAGGTTCTTCTTCGACGAGTAC
AAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGCGGCCTCCGTTTACGGCTTCCTTTGCGGC
CATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCCGTTGACGGCGGAGCATGTCATGGAGTGC
ATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCTTGAGGAGGTGGCCAATTCGGCCGAGGGC
CTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTCCCGTGGCTCCAGCAATCGGCAATGCGCTG
GCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGCAATACCCGTACGCCATGTACTTTCAGCCT
AAACCTGCCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCC
GGCAGCCCCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTC
CCCGACAAGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAG
GGCCGTATCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAAC
GGTCTGCCTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGC
GTCAGCCCCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAG
GAGACTGTTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCG
GCCAAGGGCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCC
TTGTCCGGCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAG
CTCGTGGACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCC
CAGGTGATTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAG
GCCGTCTCGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCT
GGCGAGTCGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAA
AACCTTCCTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACT
GGCTCGCTGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGC
GGCGCAGACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTG
CAGTTCGTCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAG
GTGGACCGCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGA
GGCGTCCGCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGC
TCCGTCGGTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATG
GGATACGGCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCC
GTGGTGCGTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGT
CTGGTCGCCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACG
ATGGAGGAGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGC
TACTACCACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGC
AGGATCAAGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGAC
CTGGAGCTCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAG
CCGACGGTGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGC
ATGATGCAGCACTGGTGCAAGCAGTGGCACTATTAG
Gene >Ophio5|712
ATGGTACGGCCATGCGTCGTTCGTTGGGCTTCCAATCGGTTTACCTATTACGGGCTTCTGCGCTCCTCTACCTAC
GGCCCGTGTGCTGACCCACGGGACGAATGACCCTCCTAGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTC
CGTCGACCGGGAGAGTAGGTTTTTCCTGGATGCTGATCTTTGAGGCCAACTCCTCTGATACCAACTCTTCTTCAA
TCTTAGCATTTGGGCAGTCTCAAAAACCATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCC
GGCTCTGAGGCGCCACCGCGCGACGTCAGACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCG
GCTTCTTGTCGACGTGGTCGAGGGGACGGCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTC
CAACCCTGCGGATGGTTTCGTCCAGGTGACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCAT
CACCAAGGAGCTGGGTGTGCCGGCCAAGAACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTA
CATCTTCTTCTTGGTTGCCTGTGTCAAGGCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGC
CGCCCTCTCTCTTCTCCAGGCCACCGACTGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCC
TTGGCTTCAGAACCGGCAGATGAAGCACTTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCC
TTTCCCCTACAGCAAGACGTTTGAGGAGGCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGG
CATTCCAAAGCCCATCGTCGTCCGGCAGGGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGG
CGGGGCGAGGTTCTTCTTCGACGAGTACAAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGC
GGCCTCCGTTTACGGCTTCCTTTGCGGCCATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCC
GTTGACGGCGGAGCATGTCATGGAGTGCATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCT
TGAGGAGGTGGCCAATTCGGCCGAGGGCCTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTAC
GGCAACTCTTTCATCATCTTGATGGTTTACTATGTGCTTACAGGAACTATAGGTCCCGTGGCTCCAGCAATCGGC
AATGCGCTGGCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGTCAGTCATCCGTGTCTGAATG
GGAGATGCTCCGAGCTGACCGGTCGCTGTTTTTGCAGGCAATACCCGTACGCCATGTACTTTCAGCCTAAACCTG
CCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCCGGCAGCC
CCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTCCCCGACA
AGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAGGGCCGTA
TCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAACGGTCTGC
CTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGCGTCAGCC
CCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAGGAGACTG
TTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCGGCCAAGG
GCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCCTTGTCCG
GCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAGCTCGTGG
ACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCCCAGGTGA
TTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAGGCCGTCT
CGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCTGGCGAGT
CGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAAAACCTTC
CTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACTGGCTCGC
TGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGCGGCGCAG
ACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTGCAGTTCG
TCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAGGTGGACC
GCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGAGGCGTCC
GCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGCTCCGTCG
GTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATGGGATACG
GCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCCGTGGTGC
GTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGTCTGGTCG
CCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACGATGGAGG
AGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGCTACTACC
ACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGCAGGATCA
AGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGACCTGGAGC
TCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAGCCGACGG
TGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGCATGATGC
AGCACTGGTGCAAGCAGTGGCACTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail