Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|712
Gene name
Locationscaffold_12:3267..6896
Strand-
Gene length (bp)3629
Transcript length (bp)3336
Coding sequence length (bp)3333
Protein length (aa) 1111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.2E-28 76 399
PF07993 NAD_binding_4 Male sterility protein 1.1E-26 746 983
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.6E-09 744 985
PF00550 PP-binding Phosphopantetheine attachment site 7.8E-06 623 684

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 450 1089 1.0E-14
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 642 963 3.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 743 963 2.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 728 1051 5.0E-08
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 634 1060 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 450 1089 1.0E-14
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 642 963 3.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 743 963 2.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 728 1051 5.0E-08
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 634 1060 9.0E-08
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 38 660 3.0E-07
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 733 1039 6.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5734 0.2349 0.3133 0.1706 0.289 0.1479 0.1603 0.1747 0.3273 0.2272

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 1 NRPS-like

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup69
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5467
Ophiocordyceps australis 1348a (Ghana) OphauG2|5656
Ophiocordyceps australis 1348a (Ghana) OphauG2|7764
Ophiocordyceps australis map64 (Brazil) OphauB2|1311
Ophiocordyceps australis map64 (Brazil) OphauB2|1430
Ophiocordyceps australis map64 (Brazil) OphauB2|1646
Ophiocordyceps australis map64 (Brazil) OphauB2|4739
Ophiocordyceps camponoti-floridani Ophcf2|01223
Ophiocordyceps camponoti-rufipedis Ophun1|1554
Ophiocordyceps kimflemingae Ophio5|1785
Ophiocordyceps kimflemingae Ophio5|712 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1787
Ophiocordyceps subramaniannii Hirsu2|1856
Ophiocordyceps subramaniannii Hirsu2|4184
Ophiocordyceps subramaniannii Hirsu2|5652
Ophiocordyceps subramaniannii Hirsu2|952

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|712
MAAFFYNKFAAPFRRPGDIWAVSKTMLAPQVNLGPQSGLDPALRRHRATSDLSSRGQSPANRYGHRLLVDVVEGT
AKRDPTRAFVHHPKTSNPADGFVQVTYREAVNAINHLAHLITKELGVPAKNSFPTICYIGSQDIRYIFFLVACVK
AGYKALFNSPRNSLEAALSLLQATDCHALFYAESQQKTVEPWLQNRQMKHFVIDATDNLLASEPEPFPYSKTFEE
AVWDPVVVLHTSGSTGIPKPIVVRQGSLAVADAYRNLPEIGGARFFFDEYKKRTNLYFRHMPLFHAASVYGFLCG
HIFYGIPMAFGCPDSPLTAEHVMECIKYSGSDSCMLPPSVLEEVANSAEGLALLEKMSFVTFGGGPVAPAIGNAL
AQRGILLQSAIGSTEQYPYAMYFQPKPANWQYFIFNADAMGGDFRPIDGPGSPEELVIVRKGHGQLPSQSVFFTF
PDKTEWSTNDIFMPHPELPSHWTYKGRIDNIIVFSNGEKLNPATIEDTINGLPKIKGAMVVGQGRFQPALILEPC
VSPKSDEEAAELINEVWPVIELVNKETVAHGRISKDFIGLSRPDAPFPRSAKGSLQRALAMEMYNDDIDVLYERA
LSGEAGGPVTLDLSSEKALANSIVQLVDSRIGVSGLAPETDYFDAGIDSAQVIRIASMLRAGLKHVPLPNVDLQE
AVSPKQIYANNSSQMLAGYLLSLVSGESASGQEQAREMKVMEELLAKYTQNLPGPAAGKPKPNDEGQTVVLTGTT
GSLGAYMLDMLCASPRVKKIVAMNRGADGGRSRQAGVSSDRGLGTDFSKVQFVGVDVSKPSLGMEEKEYEQVLSE
VDRVIHNAWSVNFNLNVRSFEPQIRGVRHLVDMVAAAAKQAPIAFLSSVGSVGGWQHKELAVPEHTFEDLSMPVM
GYGRSKALGSLILDAAAAQSGLHTAVVRVGQVGGPRGEKGCWNKPEYFPSLVASGLHLGVLPNDLGPRQRVDWLT
MEEVASTILEIVGATTQVKVDDISGYYHASNPNEASWPDMAQAIKDYYGGRIKNLVSLEEWQDILEKSAAAEDAD
LELNPSIKLLESHRDVIKGKRAGIKPTVLATERTIKVSPTMRASKAITPSMMQHWCKQWHY
Coding >Ophio5|712
ATGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTCCGTCGACCGGGAGACATTTGGGCAGTCTCAAAAACC
ATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCCGGCTCTGAGGCGCCACCGCGCGACGTCA
GACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCGGCTTCTTGTCGACGTGGTCGAGGGGACG
GCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTCCAACCCTGCGGATGGTTTCGTCCAGGTG
ACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCATCACCAAGGAGCTGGGTGTGCCGGCCAAG
AACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTACATCTTCTTCTTGGTTGCCTGTGTCAAG
GCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGCCGCCCTCTCTCTTCTCCAGGCCACCGAC
TGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCCTTGGCTTCAGAACCGGCAGATGAAGCAC
TTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCCTTTCCCCTACAGCAAGACGTTTGAGGAG
GCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGGCATTCCAAAGCCCATCGTCGTCCGGCAG
GGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGGCGGGGCGAGGTTCTTCTTCGACGAGTAC
AAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGCGGCCTCCGTTTACGGCTTCCTTTGCGGC
CATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCCGTTGACGGCGGAGCATGTCATGGAGTGC
ATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCTTGAGGAGGTGGCCAATTCGGCCGAGGGC
CTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTCCCGTGGCTCCAGCAATCGGCAATGCGCTG
GCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGCAATACCCGTACGCCATGTACTTTCAGCCT
AAACCTGCCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCC
GGCAGCCCCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTC
CCCGACAAGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAG
GGCCGTATCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAAC
GGTCTGCCTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGC
GTCAGCCCCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAG
GAGACTGTTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCG
GCCAAGGGCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCC
TTGTCCGGCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAG
CTCGTGGACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCC
CAGGTGATTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAG
GCCGTCTCGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCT
GGCGAGTCGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAA
AACCTTCCTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACT
GGCTCGCTGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGC
GGCGCAGACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTG
CAGTTCGTCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAG
GTGGACCGCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGA
GGCGTCCGCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGC
TCCGTCGGTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATG
GGATACGGCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCC
GTGGTGCGTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGT
CTGGTCGCCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACG
ATGGAGGAGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGC
TACTACCACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGC
AGGATCAAGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGAC
CTGGAGCTCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAG
CCGACGGTGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGC
ATGATGCAGCACTGGTGCAAGCAGTGGCACTAT
Transcript >Ophio5|712
ATGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTCCGTCGACCGGGAGACATTTGGGCAGTCTCAAAAACC
ATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCCGGCTCTGAGGCGCCACCGCGCGACGTCA
GACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCGGCTTCTTGTCGACGTGGTCGAGGGGACG
GCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTCCAACCCTGCGGATGGTTTCGTCCAGGTG
ACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCATCACCAAGGAGCTGGGTGTGCCGGCCAAG
AACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTACATCTTCTTCTTGGTTGCCTGTGTCAAG
GCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGCCGCCCTCTCTCTTCTCCAGGCCACCGAC
TGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCCTTGGCTTCAGAACCGGCAGATGAAGCAC
TTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCCTTTCCCCTACAGCAAGACGTTTGAGGAG
GCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGGCATTCCAAAGCCCATCGTCGTCCGGCAG
GGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGGCGGGGCGAGGTTCTTCTTCGACGAGTAC
AAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGCGGCCTCCGTTTACGGCTTCCTTTGCGGC
CATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCCGTTGACGGCGGAGCATGTCATGGAGTGC
ATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCTTGAGGAGGTGGCCAATTCGGCCGAGGGC
CTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTCCCGTGGCTCCAGCAATCGGCAATGCGCTG
GCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGCAATACCCGTACGCCATGTACTTTCAGCCT
AAACCTGCCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCC
GGCAGCCCCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTC
CCCGACAAGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAG
GGCCGTATCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAAC
GGTCTGCCTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGC
GTCAGCCCCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAG
GAGACTGTTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCG
GCCAAGGGCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCC
TTGTCCGGCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAG
CTCGTGGACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCC
CAGGTGATTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAG
GCCGTCTCGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCT
GGCGAGTCGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAA
AACCTTCCTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACT
GGCTCGCTGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGC
GGCGCAGACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTG
CAGTTCGTCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAG
GTGGACCGCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGA
GGCGTCCGCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGC
TCCGTCGGTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATG
GGATACGGCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCC
GTGGTGCGTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGT
CTGGTCGCCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACG
ATGGAGGAGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGC
TACTACCACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGC
AGGATCAAGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGAC
CTGGAGCTCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAG
CCGACGGTGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGC
ATGATGCAGCACTGGTGCAAGCAGTGGCACTATTAG
Gene >Ophio5|712
ATGGTACGGCCATGCGTCGTTCGTTGGGCTTCCAATCGGTTTACCTATTACGGGCTTCTGCGCTCCTCTACCTAC
GGCCCGTGTGCTGACCCACGGGACGAATGACCCTCCTAGGCCGCCTTCTTCTATAATAAGTTTGCCGCACCCTTC
CGTCGACCGGGAGAGTAGGTTTTTCCTGGATGCTGATCTTTGAGGCCAACTCCTCTGATACCAACTCTTCTTCAA
TCTTAGCATTTGGGCAGTCTCAAAAACCATGTTGGCACCGCAAGTCAATCTAGGGCCCCAGTCTGGCCTCGACCC
GGCTCTGAGGCGCCACCGCGCGACGTCAGACCTGTCGAGCCGTGGCCAGTCGCCTGCCAACAGGTATGGCCATCG
GCTTCTTGTCGACGTGGTCGAGGGGACGGCCAAGAGGGACCCGACTCGGGCCTTTGTCCATCATCCCAAGACTTC
CAACCCTGCGGATGGTTTCGTCCAGGTGACCTACAGGGAGGCGGTCAACGCCATCAACCACCTTGCCCACCTCAT
CACCAAGGAGCTGGGTGTGCCGGCCAAGAACAGCTTCCCGACCATCTGCTACATTGGGTCCCAGGACATCCGTTA
CATCTTCTTCTTGGTTGCCTGTGTCAAGGCAGGCTACAAGGCCCTTTTCAACTCACCTCGCAACAGCCTCGAGGC
CGCCCTCTCTCTTCTCCAGGCCACCGACTGCCACGCCCTCTTCTACGCCGAGTCGCAGCAGAAGACTGTGGAGCC
TTGGCTTCAGAACCGGCAGATGAAGCACTTCGTCATTGATGCCACCGACAACTTGCTGGCCTCGGAGCCTGAGCC
TTTCCCCTACAGCAAGACGTTTGAGGAGGCCGTGTGGGATCCCGTCGTTGTTCTTCACACGAGCGGATCGACGGG
CATTCCAAAGCCCATCGTCGTCCGGCAGGGATCTCTGGCCGTTGCCGACGCGTACCGCAACCTGCCCGAGATCGG
CGGGGCGAGGTTCTTCTTCGACGAGTACAAGAAGAGGACCAATCTGTACTTCCGCCACATGCCTTTGTTTCACGC
GGCCTCCGTTTACGGCTTCCTTTGCGGCCATATCTTCTACGGCATTCCCATGGCCTTTGGCTGCCCTGACAGCCC
GTTGACGGCGGAGCATGTCATGGAGTGCATCAAGTACAGCGGATCCGACTCCTGCATGCTGCCGCCGTCTGTGCT
TGAGGAGGTGGCCAATTCGGCCGAGGGCCTTGCCTTGCTGGAGAAGATGTCTTTTGTCACCTTTGGCGGAGGTAC
GGCAACTCTTTCATCATCTTGATGGTTTACTATGTGCTTACAGGAACTATAGGTCCCGTGGCTCCAGCAATCGGC
AATGCGCTGGCTCAGCGCGGCATTCTGCTGCAGAGCGCCATTGGATCGACCGAGTCAGTCATCCGTGTCTGAATG
GGAGATGCTCCGAGCTGACCGGTCGCTGTTTTTGCAGGCAATACCCGTACGCCATGTACTTTCAGCCTAAACCTG
CCAACTGGCAGTACTTCATCTTCAACGCCGATGCCATGGGCGGAGATTTCCGCCCTATCGACGGACCCGGCAGCC
CCGAGGAGCTCGTCATCGTCCGCAAAGGCCATGGCCAGCTCCCGTCGCAGTCGGTCTTCTTCACGTTCCCCGACA
AGACGGAGTGGTCGACCAACGACATCTTCATGCCTCACCCCGAGCTTCCCAGTCACTGGACGTACAAGGGCCGTA
TCGACAACATCATCGTCTTCTCCAACGGTGAGAAGCTCAATCCGGCCACCATCGAAGACACCATCAACGGTCTGC
CTAAGATCAAGGGCGCCATGGTCGTTGGCCAGGGGCGTTTCCAGCCTGCCTTGATCCTGGAACCTTGCGTCAGCC
CCAAGAGCGACGAAGAGGCCGCTGAACTGATCAATGAAGTGTGGCCGGTGATTGAGCTGGTCAACAAGGAGACTG
TTGCTCATGGCCGCATCTCCAAGGACTTCATTGGCCTCAGCCGGCCCGACGCGCCTTTCCCGCGGTCGGCCAAGG
GCTCCCTCCAACGGGCGTTGGCCATGGAAATGTACAACGACGACATTGATGTGCTGTACGAGCGCGCCTTGTCCG
GCGAGGCCGGTGGGCCGGTGACGCTCGACCTCTCGAGCGAGAAGGCGTTGGCCAACTCCATTGTCCAGCTCGTGG
ACAGCAGAATCGGTGTCTCCGGATTGGCACCCGAGACGGACTACTTCGATGCTGGCATTGATTCCGCCCAGGTGA
TTCGGATTGCATCTATGCTCCGCGCTGGCCTCAAACATGTCCCACTGCCGAATGTGGACCTGCAAGAGGCCGTCT
CGCCGAAGCAGATCTACGCAAACAACTCTTCGCAGATGCTGGCCGGCTATCTTTTGTCTCTCGTCTCTGGCGAGT
CGGCCAGTGGCCAGGAGCAGGCGAGAGAAATGAAGGTCATGGAGGAACTCCTCGCCAAGTACACGCAAAACCTTC
CTGGCCCGGCGGCGGGCAAACCCAAGCCCAACGACGAGGGGCAGACGGTTGTGCTGACGGGGACGACTGGCTCGC
TGGGTGCCTACATGCTGGACATGCTCTGCGCCTCGCCGAGGGTGAAGAAAATCGTGGCCATGAATCGCGGCGCAG
ACGGTGGCCGTTCCCGGCAGGCCGGTGTCAGCAGTGACCGTGGGCTGGGCACGGACTTCTCCAAGGTGCAGTTCG
TCGGAGTCGACGTGTCCAAGCCGTCGCTGGGCATGGAGGAGAAGGAATACGAACAGGTTCTGTCCGAGGTGGACC
GCGTCATCCACAATGCCTGGTCCGTCAATTTCAACCTCAACGTCCGCTCGTTCGAGCCGCAGATTCGAGGCGTCC
GCCATCTGGTCGACATGGTTGCTGCGGCGGCCAAGCAGGCGCCGATCGCCTTCCTCTCCAGCGTCGGCTCCGTCG
GTGGCTGGCAGCACAAGGAACTTGCCGTGCCTGAGCACACGTTTGAGGACCTTTCGATGCCCGTCATGGGATACG
GCAGGTCCAAAGCCCTCGGCAGCCTGATCCTCGATGCTGCCGCGGCCCAATCGGGCTTGCACACGGCCGTGGTGC
GTGTCGGCCAGGTCGGCGGCCCAAGGGGCGAGAAGGGATGCTGGAACAAGCCGGAATACTTCCCCAGTCTGGTCG
CCAGCGGTCTTCACCTCGGAGTCCTTCCCAACGATCTCGGCCCTAGGCAGAGAGTGGACTGGCTCACGATGGAGG
AGGTGGCGTCGACCATTCTCGAGATTGTCGGTGCGACGACGCAGGTCAAGGTCGACGACATCTCGGGCTACTACC
ACGCCTCCAACCCGAACGAGGCTTCCTGGCCTGACATGGCACAGGCCATCAAGGACTATTACGGCGGCAGGATCA
AGAACCTCGTCAGTCTGGAGGAGTGGCAGGACATTCTGGAGAAGAGCGCGGCGGCAGAGGACGCCGACCTGGAGC
TCAACCCGTCCATCAAGCTGCTCGAATCGCACAGGGACGTCATCAAAGGGAAGAGGGCCGGGATCAAGCCGACGG
TGCTAGCGACAGAAAGGACTATCAAGGTCAGCCCTACCATGCGCGCCAGCAAAGCCATCACGCCGAGCATGATGC
AGCACTGGTGCAAGCAGTGGCACTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail