Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7111
Gene name
Locationscaffold_662:3036..8394
Strand-
Gene length (bp)5358
Transcript length (bp)5358
Coding sequence length (bp)5355
Protein length (aa) 1785

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2428 0.9118 0.4307 0.0305 0.104 0.0107 0.0324 0.0188 0.0121 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6551
Ophiocordyceps australis 1348a (Ghana) OphauG2|6552
Ophiocordyceps australis map64 (Brazil) OphauB2|1204
Ophiocordyceps camponoti-floridani Ophcf2|02797
Ophiocordyceps camponoti-rufipedis Ophun1|1250
Ophiocordyceps camponoti-rufipedis Ophun1|7284
Ophiocordyceps kimflemingae Ophio5|7111 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3007

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7111
MAPARGRGNGRARGRGRGRGRGRGQSSWGNRSRSASVQPDSQPETDTGGPMTRSRQASLQRQLESDSQAGPSAQS
ATTQAGPSTQAATHVTGGFSGPSARSRGKAAVPATLSRGTSAGPATRSKGSKYQLHLPEPAQSSIQVNTSGRREL
PTIVEDSPGPGQKRNTAGTSSELPAQKRQRVGGDIPSYYNKDGSWPVAGFSRAGAAQSRTRPSQSQPAGEPASKR
RRTGGSPSGGKGGGGGGGGPSGGGDGEDDDDLFGDKELDNAGGDPDGDDSDGSDDDDDDDDDDNDGGGGGNGDPD
DDDDDDDDGPPDNNSGDRRVKPCKRCREHAKSYKAAVRRNPNNPGMDPLPRCDWNPADRMSRECTNCANLRFDTG
VQVTCEVERHPDLWRSYSDRHPTVFNPTRCASCIASNSDNCNVDPYLGFACSACVRAKKTEPGLECVVEGETMGE
RPNPRQGVERWYRRQCDTCANPKPKKGQPGCSWLRDRNNWGQPCDQCRERGFPCIDSGVTVGLIPPPKPPTEWAV
SKHLNGSWAEIRGNTPWRKCCTACVDNHGHCRAMADSAEFSCNRCFQLGIDCIDLVKSQDEELKIRSQFDLSRVG
FGNFLPFFACGRCKETGRNCDHQRPCDSCFYAGEADLCAQPDVNKAGTGYFNKRLATPAGPLYYLALGYGASGVN
EIKDGSQLEHWIGPPFPVYSMVGPHHGDGQYQGRARDDSNKMAIVSLALDQRASLRPPHAPPHGGPGGGLPMKPP
SEITVEELREALWAKWPGIYPMNQHPKYQEVSQEAPRKRAKLFHDAKVQRVIEPGTEATVKEKRAANREASKLAA
GGVGPGALARALSEAAAGPSTAPPPPPPDRILRSMRHPDTPQESGAGVDSVDSGPDLGEDDTPFDDDFALHRLRE
QQEQMRRLQEQQEQMRQLQEQQRQLQEQQWQEQQWQEQQRQLQEQQRQEQERQRQEQEQDQQQQRPNNDPASRQE
FLNSAWMMTGSLGPPLHHLVGIGEPPHGPLYDAPPPAETAQMRKLFMGTFSALAGDRAMRLFIEPLAAKFEQDMN
DFEQHIASLPPVPPPPAPPGGDPPGGGPPGGDPPGGDPPGGGPPGGGPPSNEDMGGDPFAGFSRPDPTFGSDEFA
NAPRGSNAYDGSGPSNQPDTFGGGDRPDPYFGGGGGGGGSGGKEPNEAERLASRGNEANAADPWEEDRDAIGKPA
DSDEQPHAGPHQSSDPEGDQDASGETVESEEDRDASGEPAEFDQENAPPEQGVSDDFSKGQQQTRTEQTQDSGSG
SDSSGRPGRSELEFSEAADLMNQNDELRQEDRRGHDDSDPLRQTGGDGTTQIFEDPSSPSHQPEDGDEDAEGEDV
EEEEDDEIENRPPPVDAALPTQQGNHSHPPATGPGSAPASTRDGVFAAARRLLNAIAGGRSAAPSSSSSGQAREP
LAPLNAQQQPPPPSSSESSEANTSLISDRSAVYAAERWSLSDPSADVKNYWETMHFQRQGSPSPQFRLFNIVNGM
VGAEALPCSTAGNVPFYNELRRVLVSEMDGEAPERRLHPVLCADPGTQHEFCGAALGPDMACVSKDHTEGAQFGA
GVCGDCAQHSAEILCDASQAGITSAEIKSMRAYLCGDCSQACRSLESIGPNLICQGVASIYGATQWTEQGPLTLD
AGGLSIRVHAQAFPVTGCSCGAKMLDARLCRQHRLFYARKAMGRVETMGRWRLAAFAGRECCPTCLADKSALESG
LSTDWSEGQPGAWICMQCNGAVINQPHRGLVQGWDTWLANPSADWAVVDAEDGPGADRSV
Coding >Ophio5|7111
ATGGCTCCTGCCAGAGGAAGAGGAAATGGACGAGCAAGAGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGTCAA
TCTTCATGGGGGAACCGATCTAGGTCGGCCTCGGTGCAGCCGGATTCGCAGCCCGAAACGGACACGGGCGGCCCT
ATGACGCGCTCGAGGCAGGCCTCGCTACAGCGTCAGCTTGAAAGCGACAGCCAGGCCGGACCCTCGGCCCAGTCG
GCCACCACCCAGGCCGGACCTTCGACCCAAGCGGCCACTCACGTCACGGGGGGTTTTTCCGGTCCGTCCGCCCGG
TCGAGGGGAAAGGCGGCCGTCCCGGCCACCCTGTCAAGGGGGACGTCGGCCGGTCCGGCCACCCGGTCTAAGGGG
TCCAAGTACCAACTTCATCTTCCCGAACCGGCCCAGTCCTCCATCCAGGTGAACACTTCGGGCAGACGGGAGCTC
CCTACCATCGTCGAGGACAGCCCCGGTCCGGGTCAGAAGCGCAACACGGCGGGCACGTCGAGTGAGCTTCCCGCT
CAGAAGAGGCAGCGAGTGGGTGGCGACATCCCCAGCTACTACAACAAAGACGGATCTTGGCCCGTCGCAGGCTTC
AGTCGAGCCGGTGCGGCTCAGAGCCGGACCAGACCGTCTCAGAGCCAGCCGGCCGGGGAACCGGCGTCGAAACGA
AGACGGACCGGGGGGTCGCCATCCGGCGGCAAGGGAGGAGGAGGAGGTGGTGGAGGTCCTTCCGGGGGCGGAGAT
GGAGAGGATGACGATGATTTGTTTGGGGACAAGGAACTCGACAATGCAGGCGGCGACCCTGACGGCGATGATAGT
GACGGCTCTGACGACGACGACGACGACGACGACGACGACAATGATGGCGGCGGCGGCGGTAACGGCGATCCTGAT
GACGACGACGACGACGACGACGACGGACCCCCTGACAACAACTCTGGCGACAGAAGAGTCAAACCCTGCAAACGT
TGCCGTGAACACGCCAAGTCATACAAAGCCGCGGTGAGAAGAAATCCAAACAACCCGGGAATGGACCCCCTGCCG
AGGTGTGACTGGAACCCGGCGGACAGGATGTCCCGAGAATGCACCAACTGTGCCAATCTTCGGTTCGATACCGGC
GTCCAAGTCACATGCGAGGTCGAAAGGCATCCCGACCTCTGGCGGAGCTACTCGGACCGGCATCCGACCGTCTTC
AACCCGACTCGCTGTGCAAGCTGCATAGCGTCCAACAGCGACAACTGCAATGTCGACCCTTACCTTGGCTTCGCT
TGCAGCGCCTGCGTCAGGGCCAAGAAAACGGAGCCGGGGCTGGAGTGCGTGGTCGAGGGTGAGACGATGGGGGAG
AGGCCCAACCCGCGTCAAGGCGTCGAGCGTTGGTATCGTCGTCAGTGCGATACCTGTGCCAACCCCAAGCCGAAG
AAGGGCCAGCCCGGTTGCAGCTGGCTCCGGGATCGCAACAACTGGGGCCAGCCGTGCGACCAGTGCCGCGAAAGG
GGCTTCCCCTGCATCGACTCGGGCGTCACCGTCGGCCTCATACCGCCGCCCAAGCCACCGACGGAGTGGGCCGTC
TCCAAGCACCTCAACGGCTCCTGGGCCGAGATCCGCGGCAACACGCCGTGGCGGAAATGCTGCACTGCTTGCGTG
GATAACCACGGCCATTGTCGGGCCATGGCCGACTCGGCCGAGTTCTCCTGCAACCGGTGCTTTCAGCTGGGCATC
GATTGTATTGACTTGGTCAAGTCCCAGGACGAGGAGCTCAAGATTCGTTCCCAGTTTGACCTTAGTCGAGTTGGT
TTCGGCAACTTCTTACCCTTCTTTGCCTGTGGCCGCTGCAAGGAAACGGGACGAAACTGCGATCATCAGCGTCCT
TGCGACTCGTGCTTCTATGCCGGAGAGGCCGACCTTTGCGCCCAGCCGGATGTCAACAAGGCCGGAACCGGCTAC
TTCAACAAGCGGCTTGCCACACCTGCCGGACCTCTCTACTACCTGGCTCTCGGCTACGGCGCCAGCGGCGTCAAC
GAGATCAAGGACGGCTCCCAACTGGAGCACTGGATCGGTCCGCCTTTCCCCGTCTATTCCATGGTGGGTCCCCAC
CATGGGGATGGACAATATCAGGGCAGAGCCAGGGACGACTCCAACAAGATGGCCATCGTGTCGCTGGCTCTCGAC
CAGCGAGCGAGCTTGAGGCCGCCTCACGCCCCTCCCCACGGCGGTCCCGGCGGTGGCCTTCCGATGAAGCCACCG
AGCGAGATCACGGTGGAAGAGTTGAGGGAAGCACTCTGGGCCAAGTGGCCGGGCATTTACCCCATGAACCAGCAT
CCCAAGTACCAAGAGGTTAGCCAAGAGGCCCCTCGCAAACGGGCCAAGTTGTTTCACGACGCCAAGGTACAAAGA
GTCATCGAGCCGGGAACCGAAGCCACTGTCAAGGAAAAGAGGGCCGCAAACAGAGAGGCTTCCAAGCTCGCTGCC
GGCGGTGTCGGTCCCGGTGCCCTCGCCCGAGCTTTAAGTGAAGCAGCCGCAGGACCGTCAACTGCACCGCCGCCG
CCGCCGCCGGATCGCATCTTGCGATCGATGCGGCATCCCGATACGCCGCAGGAGTCCGGAGCGGGAGTCGATTCA
GTCGATTCGGGACCAGACTTGGGAGAGGATGATACACCATTCGATGACGACTTTGCCTTGCACCGGCTGCGGGAG
CAGCAGGAGCAAATGCGGCGGCTACAGGAGCAGCAGGAGCAAATGCGGCAGCTACAGGAGCAGCAGCGGCAGCTA
CAGGAGCAGCAGTGGCAGGAGCAGCAGTGGCAGGAGCAGCAGCGGCAGCTGCAGGAGCAGCAGCGGCAGGAGCAG
GAGCGGCAGCGGCAGGAGCAGGAGCAGGATCAGCAGCAGCAGCGACCTAACAACGACCCAGCTTCGCGTCAGGAA
TTCCTAAATTCTGCTTGGATGATGACAGGATCCTTGGGACCACCATTGCATCATCTCGTGGGCATTGGCGAACCA
CCGCATGGACCACTATACGACGCTCCGCCGCCCGCTGAAACCGCTCAGATGCGCAAGCTTTTCATGGGCACTTTC
TCAGCCTTGGCCGGCGACAGGGCGATGCGGTTGTTCATCGAGCCTCTAGCGGCCAAGTTCGAACAGGACATGAAC
GACTTTGAACAGCACATCGCGAGTCTGCCGCCCGTGCCTCCTCCGCCAGCGCCTCCCGGTGGCGACCCTCCCGGT
GGCGGCCCTCCCGGTGGCGACCCTCCCGGTGGCGACCCTCCCGGCGGCGGCCCCCCGGGTGGCGGTCCTCCCAGT
AACGAAGACATGGGCGGAGACCCGTTTGCCGGCTTTTCGAGGCCGGATCCCACCTTCGGGTCGGATGAATTTGCA
AACGCTCCCCGGGGGTCAAATGCGTATGACGGCAGCGGCCCTTCCAACCAACCGGATACGTTTGGCGGAGGAGAC
AGGCCGGACCCGTACTTCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGAGGTAAAGAGCCCAACGAAGCGGAAAGG
CTTGCCAGCCGAGGAAACGAGGCGAACGCAGCAGACCCGTGGGAAGAGGATCGAGATGCAATAGGCAAACCAGCT
GATTCCGATGAGCAGCCACATGCTGGGCCACACCAGTCGTCTGATCCGGAAGGGGATCAAGATGCGTCGGGCGAA
ACGGTCGAATCGGAAGAGGATCGAGACGCCTCGGGCGAACCAGCCGAATTCGACCAAGAAAATGCGCCACCGGAA
CAGGGAGTCTCGGATGATTTCTCCAAAGGACAGCAGCAAACAAGAACGGAGCAAACACAAGACAGCGGCAGCGGC
AGCGACAGCAGTGGCCGCCCCGGCCGATCCGAACTCGAATTTAGTGAAGCCGCGGATCTGATGAACCAAAACGAC
GAGTTGCGGCAGGAGGATAGGAGAGGACATGATGATTCGGATCCGCTGCGGCAGACGGGCGGTGACGGGACGACG
CAGATCTTTGAGGATCCTTCTTCGCCTTCGCACCAACCGGAGGATGGAGATGAAGACGCAGAAGGAGAGGATGTT
GAGGAAGAGGAGGACGACGAGATAGAAAACCGGCCCCCGCCCGTCGATGCTGCCCTTCCGACGCAGCAGGGCAAC
CATTCTCATCCGCCGGCGACAGGACCGGGAAGTGCTCCGGCCTCGACCAGAGACGGCGTCTTCGCAGCCGCCAGG
CGCCTCCTCAACGCCATCGCCGGCGGCAGGAGTGCCGCCCCGTCGTCGTCGTCATCGGGTCAAGCACGCGAGCCG
CTGGCTCCGCTCAACGCTCAGCAGCAGCCGCCACCACCATCATCGTCCGAGAGTTCGGAAGCCAACACAAGCCTC
ATCTCGGACCGCAGCGCCGTGTACGCGGCGGAACGATGGTCTTTGTCGGACCCGTCGGCGGACGTGAAGAACTAC
TGGGAGACGATGCATTTCCAGCGCCAAGGGTCGCCATCGCCTCAGTTCCGTCTTTTCAACATCGTCAACGGCATG
GTGGGCGCAGAAGCGCTTCCGTGTTCGACAGCGGGCAACGTGCCATTTTATAACGAGTTGAGACGCGTCCTCGTC
TCGGAGATGGACGGAGAGGCGCCGGAGCGGAGGCTGCATCCGGTCTTGTGCGCTGATCCGGGTACGCAGCATGAG
TTTTGCGGTGCTGCTCTGGGGCCCGACATGGCCTGCGTCTCCAAGGATCATACTGAAGGCGCCCAGTTCGGAGCG
GGCGTCTGCGGGGATTGCGCGCAGCACAGCGCGGAAATACTCTGCGACGCGTCCCAGGCCGGCATCACCAGCGCC
GAGATCAAGTCGATGCGTGCCTATCTCTGCGGCGACTGCTCGCAAGCCTGCCGGTCGCTCGAGAGCATCGGGCCC
AACCTCATCTGCCAAGGCGTCGCATCCATCTACGGCGCCACACAATGGACAGAACAAGGTCCCCTCACCCTCGAC
GCGGGCGGCCTAAGCATACGGGTCCATGCGCAAGCTTTCCCGGTGACGGGATGCAGCTGCGGCGCAAAGATGTTG
GACGCTCGCCTATGTCGTCAACATCGTCTCTTCTACGCCCGAAAGGCCATGGGACGGGTCGAGACGATGGGCAGA
TGGCGATTGGCTGCCTTTGCCGGTCGCGAGTGCTGTCCGACCTGTCTGGCGGATAAATCGGCCTTGGAGTCCGGC
CTGTCGACGGACTGGTCCGAGGGGCAGCCCGGAGCCTGGATCTGTATGCAGTGCAACGGCGCCGTCATCAACCAG
CCCCATCGAGGCCTCGTCCAAGGATGGGACACGTGGCTCGCTAACCCGTCCGCCGATTGGGCCGTCGTCGACGCT
GAGGATGGGCCTGGCGCCGACAGATCTGTT
Transcript >Ophio5|7111
ATGGCTCCTGCCAGAGGAAGAGGAAATGGACGAGCAAGAGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGTCAA
TCTTCATGGGGGAACCGATCTAGGTCGGCCTCGGTGCAGCCGGATTCGCAGCCCGAAACGGACACGGGCGGCCCT
ATGACGCGCTCGAGGCAGGCCTCGCTACAGCGTCAGCTTGAAAGCGACAGCCAGGCCGGACCCTCGGCCCAGTCG
GCCACCACCCAGGCCGGACCTTCGACCCAAGCGGCCACTCACGTCACGGGGGGTTTTTCCGGTCCGTCCGCCCGG
TCGAGGGGAAAGGCGGCCGTCCCGGCCACCCTGTCAAGGGGGACGTCGGCCGGTCCGGCCACCCGGTCTAAGGGG
TCCAAGTACCAACTTCATCTTCCCGAACCGGCCCAGTCCTCCATCCAGGTGAACACTTCGGGCAGACGGGAGCTC
CCTACCATCGTCGAGGACAGCCCCGGTCCGGGTCAGAAGCGCAACACGGCGGGCACGTCGAGTGAGCTTCCCGCT
CAGAAGAGGCAGCGAGTGGGTGGCGACATCCCCAGCTACTACAACAAAGACGGATCTTGGCCCGTCGCAGGCTTC
AGTCGAGCCGGTGCGGCTCAGAGCCGGACCAGACCGTCTCAGAGCCAGCCGGCCGGGGAACCGGCGTCGAAACGA
AGACGGACCGGGGGGTCGCCATCCGGCGGCAAGGGAGGAGGAGGAGGTGGTGGAGGTCCTTCCGGGGGCGGAGAT
GGAGAGGATGACGATGATTTGTTTGGGGACAAGGAACTCGACAATGCAGGCGGCGACCCTGACGGCGATGATAGT
GACGGCTCTGACGACGACGACGACGACGACGACGACGACAATGATGGCGGCGGCGGCGGTAACGGCGATCCTGAT
GACGACGACGACGACGACGACGACGGACCCCCTGACAACAACTCTGGCGACAGAAGAGTCAAACCCTGCAAACGT
TGCCGTGAACACGCCAAGTCATACAAAGCCGCGGTGAGAAGAAATCCAAACAACCCGGGAATGGACCCCCTGCCG
AGGTGTGACTGGAACCCGGCGGACAGGATGTCCCGAGAATGCACCAACTGTGCCAATCTTCGGTTCGATACCGGC
GTCCAAGTCACATGCGAGGTCGAAAGGCATCCCGACCTCTGGCGGAGCTACTCGGACCGGCATCCGACCGTCTTC
AACCCGACTCGCTGTGCAAGCTGCATAGCGTCCAACAGCGACAACTGCAATGTCGACCCTTACCTTGGCTTCGCT
TGCAGCGCCTGCGTCAGGGCCAAGAAAACGGAGCCGGGGCTGGAGTGCGTGGTCGAGGGTGAGACGATGGGGGAG
AGGCCCAACCCGCGTCAAGGCGTCGAGCGTTGGTATCGTCGTCAGTGCGATACCTGTGCCAACCCCAAGCCGAAG
AAGGGCCAGCCCGGTTGCAGCTGGCTCCGGGATCGCAACAACTGGGGCCAGCCGTGCGACCAGTGCCGCGAAAGG
GGCTTCCCCTGCATCGACTCGGGCGTCACCGTCGGCCTCATACCGCCGCCCAAGCCACCGACGGAGTGGGCCGTC
TCCAAGCACCTCAACGGCTCCTGGGCCGAGATCCGCGGCAACACGCCGTGGCGGAAATGCTGCACTGCTTGCGTG
GATAACCACGGCCATTGTCGGGCCATGGCCGACTCGGCCGAGTTCTCCTGCAACCGGTGCTTTCAGCTGGGCATC
GATTGTATTGACTTGGTCAAGTCCCAGGACGAGGAGCTCAAGATTCGTTCCCAGTTTGACCTTAGTCGAGTTGGT
TTCGGCAACTTCTTACCCTTCTTTGCCTGTGGCCGCTGCAAGGAAACGGGACGAAACTGCGATCATCAGCGTCCT
TGCGACTCGTGCTTCTATGCCGGAGAGGCCGACCTTTGCGCCCAGCCGGATGTCAACAAGGCCGGAACCGGCTAC
TTCAACAAGCGGCTTGCCACACCTGCCGGACCTCTCTACTACCTGGCTCTCGGCTACGGCGCCAGCGGCGTCAAC
GAGATCAAGGACGGCTCCCAACTGGAGCACTGGATCGGTCCGCCTTTCCCCGTCTATTCCATGGTGGGTCCCCAC
CATGGGGATGGACAATATCAGGGCAGAGCCAGGGACGACTCCAACAAGATGGCCATCGTGTCGCTGGCTCTCGAC
CAGCGAGCGAGCTTGAGGCCGCCTCACGCCCCTCCCCACGGCGGTCCCGGCGGTGGCCTTCCGATGAAGCCACCG
AGCGAGATCACGGTGGAAGAGTTGAGGGAAGCACTCTGGGCCAAGTGGCCGGGCATTTACCCCATGAACCAGCAT
CCCAAGTACCAAGAGGTTAGCCAAGAGGCCCCTCGCAAACGGGCCAAGTTGTTTCACGACGCCAAGGTACAAAGA
GTCATCGAGCCGGGAACCGAAGCCACTGTCAAGGAAAAGAGGGCCGCAAACAGAGAGGCTTCCAAGCTCGCTGCC
GGCGGTGTCGGTCCCGGTGCCCTCGCCCGAGCTTTAAGTGAAGCAGCCGCAGGACCGTCAACTGCACCGCCGCCG
CCGCCGCCGGATCGCATCTTGCGATCGATGCGGCATCCCGATACGCCGCAGGAGTCCGGAGCGGGAGTCGATTCA
GTCGATTCGGGACCAGACTTGGGAGAGGATGATACACCATTCGATGACGACTTTGCCTTGCACCGGCTGCGGGAG
CAGCAGGAGCAAATGCGGCGGCTACAGGAGCAGCAGGAGCAAATGCGGCAGCTACAGGAGCAGCAGCGGCAGCTA
CAGGAGCAGCAGTGGCAGGAGCAGCAGTGGCAGGAGCAGCAGCGGCAGCTGCAGGAGCAGCAGCGGCAGGAGCAG
GAGCGGCAGCGGCAGGAGCAGGAGCAGGATCAGCAGCAGCAGCGACCTAACAACGACCCAGCTTCGCGTCAGGAA
TTCCTAAATTCTGCTTGGATGATGACAGGATCCTTGGGACCACCATTGCATCATCTCGTGGGCATTGGCGAACCA
CCGCATGGACCACTATACGACGCTCCGCCGCCCGCTGAAACCGCTCAGATGCGCAAGCTTTTCATGGGCACTTTC
TCAGCCTTGGCCGGCGACAGGGCGATGCGGTTGTTCATCGAGCCTCTAGCGGCCAAGTTCGAACAGGACATGAAC
GACTTTGAACAGCACATCGCGAGTCTGCCGCCCGTGCCTCCTCCGCCAGCGCCTCCCGGTGGCGACCCTCCCGGT
GGCGGCCCTCCCGGTGGCGACCCTCCCGGTGGCGACCCTCCCGGCGGCGGCCCCCCGGGTGGCGGTCCTCCCAGT
AACGAAGACATGGGCGGAGACCCGTTTGCCGGCTTTTCGAGGCCGGATCCCACCTTCGGGTCGGATGAATTTGCA
AACGCTCCCCGGGGGTCAAATGCGTATGACGGCAGCGGCCCTTCCAACCAACCGGATACGTTTGGCGGAGGAGAC
AGGCCGGACCCGTACTTCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGAGGTAAAGAGCCCAACGAAGCGGAAAGG
CTTGCCAGCCGAGGAAACGAGGCGAACGCAGCAGACCCGTGGGAAGAGGATCGAGATGCAATAGGCAAACCAGCT
GATTCCGATGAGCAGCCACATGCTGGGCCACACCAGTCGTCTGATCCGGAAGGGGATCAAGATGCGTCGGGCGAA
ACGGTCGAATCGGAAGAGGATCGAGACGCCTCGGGCGAACCAGCCGAATTCGACCAAGAAAATGCGCCACCGGAA
CAGGGAGTCTCGGATGATTTCTCCAAAGGACAGCAGCAAACAAGAACGGAGCAAACACAAGACAGCGGCAGCGGC
AGCGACAGCAGTGGCCGCCCCGGCCGATCCGAACTCGAATTTAGTGAAGCCGCGGATCTGATGAACCAAAACGAC
GAGTTGCGGCAGGAGGATAGGAGAGGACATGATGATTCGGATCCGCTGCGGCAGACGGGCGGTGACGGGACGACG
CAGATCTTTGAGGATCCTTCTTCGCCTTCGCACCAACCGGAGGATGGAGATGAAGACGCAGAAGGAGAGGATGTT
GAGGAAGAGGAGGACGACGAGATAGAAAACCGGCCCCCGCCCGTCGATGCTGCCCTTCCGACGCAGCAGGGCAAC
CATTCTCATCCGCCGGCGACAGGACCGGGAAGTGCTCCGGCCTCGACCAGAGACGGCGTCTTCGCAGCCGCCAGG
CGCCTCCTCAACGCCATCGCCGGCGGCAGGAGTGCCGCCCCGTCGTCGTCGTCATCGGGTCAAGCACGCGAGCCG
CTGGCTCCGCTCAACGCTCAGCAGCAGCCGCCACCACCATCATCGTCCGAGAGTTCGGAAGCCAACACAAGCCTC
ATCTCGGACCGCAGCGCCGTGTACGCGGCGGAACGATGGTCTTTGTCGGACCCGTCGGCGGACGTGAAGAACTAC
TGGGAGACGATGCATTTCCAGCGCCAAGGGTCGCCATCGCCTCAGTTCCGTCTTTTCAACATCGTCAACGGCATG
GTGGGCGCAGAAGCGCTTCCGTGTTCGACAGCGGGCAACGTGCCATTTTATAACGAGTTGAGACGCGTCCTCGTC
TCGGAGATGGACGGAGAGGCGCCGGAGCGGAGGCTGCATCCGGTCTTGTGCGCTGATCCGGGTACGCAGCATGAG
TTTTGCGGTGCTGCTCTGGGGCCCGACATGGCCTGCGTCTCCAAGGATCATACTGAAGGCGCCCAGTTCGGAGCG
GGCGTCTGCGGGGATTGCGCGCAGCACAGCGCGGAAATACTCTGCGACGCGTCCCAGGCCGGCATCACCAGCGCC
GAGATCAAGTCGATGCGTGCCTATCTCTGCGGCGACTGCTCGCAAGCCTGCCGGTCGCTCGAGAGCATCGGGCCC
AACCTCATCTGCCAAGGCGTCGCATCCATCTACGGCGCCACACAATGGACAGAACAAGGTCCCCTCACCCTCGAC
GCGGGCGGCCTAAGCATACGGGTCCATGCGCAAGCTTTCCCGGTGACGGGATGCAGCTGCGGCGCAAAGATGTTG
GACGCTCGCCTATGTCGTCAACATCGTCTCTTCTACGCCCGAAAGGCCATGGGACGGGTCGAGACGATGGGCAGA
TGGCGATTGGCTGCCTTTGCCGGTCGCGAGTGCTGTCCGACCTGTCTGGCGGATAAATCGGCCTTGGAGTCCGGC
CTGTCGACGGACTGGTCCGAGGGGCAGCCCGGAGCCTGGATCTGTATGCAGTGCAACGGCGCCGTCATCAACCAG
CCCCATCGAGGCCTCGTCCAAGGATGGGACACGTGGCTCGCTAACCCGTCCGCCGATTGGGCCGTCGTCGACGCT
GAGGATGGGCCTGGCGCCGACAGATCTGTTTAA
Gene >Ophio5|7111
ATGGCTCCTGCCAGAGGAAGAGGAAATGGACGAGCAAGAGGCCGGGGCCGGGGCCGGGGCCGGGGCCGGGGTCAA
TCTTCATGGGGGAACCGATCTAGGTCGGCCTCGGTGCAGCCGGATTCGCAGCCCGAAACGGACACGGGCGGCCCT
ATGACGCGCTCGAGGCAGGCCTCGCTACAGCGTCAGCTTGAAAGCGACAGCCAGGCCGGACCCTCGGCCCAGTCG
GCCACCACCCAGGCCGGACCTTCGACCCAAGCGGCCACTCACGTCACGGGGGGTTTTTCCGGTCCGTCCGCCCGG
TCGAGGGGAAAGGCGGCCGTCCCGGCCACCCTGTCAAGGGGGACGTCGGCCGGTCCGGCCACCCGGTCTAAGGGG
TCCAAGTACCAACTTCATCTTCCCGAACCGGCCCAGTCCTCCATCCAGGTGAACACTTCGGGCAGACGGGAGCTC
CCTACCATCGTCGAGGACAGCCCCGGTCCGGGTCAGAAGCGCAACACGGCGGGCACGTCGAGTGAGCTTCCCGCT
CAGAAGAGGCAGCGAGTGGGTGGCGACATCCCCAGCTACTACAACAAAGACGGATCTTGGCCCGTCGCAGGCTTC
AGTCGAGCCGGTGCGGCTCAGAGCCGGACCAGACCGTCTCAGAGCCAGCCGGCCGGGGAACCGGCGTCGAAACGA
AGACGGACCGGGGGGTCGCCATCCGGCGGCAAGGGAGGAGGAGGAGGTGGTGGAGGTCCTTCCGGGGGCGGAGAT
GGAGAGGATGACGATGATTTGTTTGGGGACAAGGAACTCGACAATGCAGGCGGCGACCCTGACGGCGATGATAGT
GACGGCTCTGACGACGACGACGACGACGACGACGACGACAATGATGGCGGCGGCGGCGGTAACGGCGATCCTGAT
GACGACGACGACGACGACGACGACGGACCCCCTGACAACAACTCTGGCGACAGAAGAGTCAAACCCTGCAAACGT
TGCCGTGAACACGCCAAGTCATACAAAGCCGCGGTGAGAAGAAATCCAAACAACCCGGGAATGGACCCCCTGCCG
AGGTGTGACTGGAACCCGGCGGACAGGATGTCCCGAGAATGCACCAACTGTGCCAATCTTCGGTTCGATACCGGC
GTCCAAGTCACATGCGAGGTCGAAAGGCATCCCGACCTCTGGCGGAGCTACTCGGACCGGCATCCGACCGTCTTC
AACCCGACTCGCTGTGCAAGCTGCATAGCGTCCAACAGCGACAACTGCAATGTCGACCCTTACCTTGGCTTCGCT
TGCAGCGCCTGCGTCAGGGCCAAGAAAACGGAGCCGGGGCTGGAGTGCGTGGTCGAGGGTGAGACGATGGGGGAG
AGGCCCAACCCGCGTCAAGGCGTCGAGCGTTGGTATCGTCGTCAGTGCGATACCTGTGCCAACCCCAAGCCGAAG
AAGGGCCAGCCCGGTTGCAGCTGGCTCCGGGATCGCAACAACTGGGGCCAGCCGTGCGACCAGTGCCGCGAAAGG
GGCTTCCCCTGCATCGACTCGGGCGTCACCGTCGGCCTCATACCGCCGCCCAAGCCACCGACGGAGTGGGCCGTC
TCCAAGCACCTCAACGGCTCCTGGGCCGAGATCCGCGGCAACACGCCGTGGCGGAAATGCTGCACTGCTTGCGTG
GATAACCACGGCCATTGTCGGGCCATGGCCGACTCGGCCGAGTTCTCCTGCAACCGGTGCTTTCAGCTGGGCATC
GATTGTATTGACTTGGTCAAGTCCCAGGACGAGGAGCTCAAGATTCGTTCCCAGTTTGACCTTAGTCGAGTTGGT
TTCGGCAACTTCTTACCCTTCTTTGCCTGTGGCCGCTGCAAGGAAACGGGACGAAACTGCGATCATCAGCGTCCT
TGCGACTCGTGCTTCTATGCCGGAGAGGCCGACCTTTGCGCCCAGCCGGATGTCAACAAGGCCGGAACCGGCTAC
TTCAACAAGCGGCTTGCCACACCTGCCGGACCTCTCTACTACCTGGCTCTCGGCTACGGCGCCAGCGGCGTCAAC
GAGATCAAGGACGGCTCCCAACTGGAGCACTGGATCGGTCCGCCTTTCCCCGTCTATTCCATGGTGGGTCCCCAC
CATGGGGATGGACAATATCAGGGCAGAGCCAGGGACGACTCCAACAAGATGGCCATCGTGTCGCTGGCTCTCGAC
CAGCGAGCGAGCTTGAGGCCGCCTCACGCCCCTCCCCACGGCGGTCCCGGCGGTGGCCTTCCGATGAAGCCACCG
AGCGAGATCACGGTGGAAGAGTTGAGGGAAGCACTCTGGGCCAAGTGGCCGGGCATTTACCCCATGAACCAGCAT
CCCAAGTACCAAGAGGTTAGCCAAGAGGCCCCTCGCAAACGGGCCAAGTTGTTTCACGACGCCAAGGTACAAAGA
GTCATCGAGCCGGGAACCGAAGCCACTGTCAAGGAAAAGAGGGCCGCAAACAGAGAGGCTTCCAAGCTCGCTGCC
GGCGGTGTCGGTCCCGGTGCCCTCGCCCGAGCTTTAAGTGAAGCAGCCGCAGGACCGTCAACTGCACCGCCGCCG
CCGCCGCCGGATCGCATCTTGCGATCGATGCGGCATCCCGATACGCCGCAGGAGTCCGGAGCGGGAGTCGATTCA
GTCGATTCGGGACCAGACTTGGGAGAGGATGATACACCATTCGATGACGACTTTGCCTTGCACCGGCTGCGGGAG
CAGCAGGAGCAAATGCGGCGGCTACAGGAGCAGCAGGAGCAAATGCGGCAGCTACAGGAGCAGCAGCGGCAGCTA
CAGGAGCAGCAGTGGCAGGAGCAGCAGTGGCAGGAGCAGCAGCGGCAGCTGCAGGAGCAGCAGCGGCAGGAGCAG
GAGCGGCAGCGGCAGGAGCAGGAGCAGGATCAGCAGCAGCAGCGACCTAACAACGACCCAGCTTCGCGTCAGGAA
TTCCTAAATTCTGCTTGGATGATGACAGGATCCTTGGGACCACCATTGCATCATCTCGTGGGCATTGGCGAACCA
CCGCATGGACCACTATACGACGCTCCGCCGCCCGCTGAAACCGCTCAGATGCGCAAGCTTTTCATGGGCACTTTC
TCAGCCTTGGCCGGCGACAGGGCGATGCGGTTGTTCATCGAGCCTCTAGCGGCCAAGTTCGAACAGGACATGAAC
GACTTTGAACAGCACATCGCGAGTCTGCCGCCCGTGCCTCCTCCGCCAGCGCCTCCCGGTGGCGACCCTCCCGGT
GGCGGCCCTCCCGGTGGCGACCCTCCCGGTGGCGACCCTCCCGGCGGCGGCCCCCCGGGTGGCGGTCCTCCCAGT
AACGAAGACATGGGCGGAGACCCGTTTGCCGGCTTTTCGAGGCCGGATCCCACCTTCGGGTCGGATGAATTTGCA
AACGCTCCCCGGGGGTCAAATGCGTATGACGGCAGCGGCCCTTCCAACCAACCGGATACGTTTGGCGGAGGAGAC
AGGCCGGACCCGTACTTCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGAGGTAAAGAGCCCAACGAAGCGGAAAGG
CTTGCCAGCCGAGGAAACGAGGCGAACGCAGCAGACCCGTGGGAAGAGGATCGAGATGCAATAGGCAAACCAGCT
GATTCCGATGAGCAGCCACATGCTGGGCCACACCAGTCGTCTGATCCGGAAGGGGATCAAGATGCGTCGGGCGAA
ACGGTCGAATCGGAAGAGGATCGAGACGCCTCGGGCGAACCAGCCGAATTCGACCAAGAAAATGCGCCACCGGAA
CAGGGAGTCTCGGATGATTTCTCCAAAGGACAGCAGCAAACAAGAACGGAGCAAACACAAGACAGCGGCAGCGGC
AGCGACAGCAGTGGCCGCCCCGGCCGATCCGAACTCGAATTTAGTGAAGCCGCGGATCTGATGAACCAAAACGAC
GAGTTGCGGCAGGAGGATAGGAGAGGACATGATGATTCGGATCCGCTGCGGCAGACGGGCGGTGACGGGACGACG
CAGATCTTTGAGGATCCTTCTTCGCCTTCGCACCAACCGGAGGATGGAGATGAAGACGCAGAAGGAGAGGATGTT
GAGGAAGAGGAGGACGACGAGATAGAAAACCGGCCCCCGCCCGTCGATGCTGCCCTTCCGACGCAGCAGGGCAAC
CATTCTCATCCGCCGGCGACAGGACCGGGAAGTGCTCCGGCCTCGACCAGAGACGGCGTCTTCGCAGCCGCCAGG
CGCCTCCTCAACGCCATCGCCGGCGGCAGGAGTGCCGCCCCGTCGTCGTCGTCATCGGGTCAAGCACGCGAGCCG
CTGGCTCCGCTCAACGCTCAGCAGCAGCCGCCACCACCATCATCGTCCGAGAGTTCGGAAGCCAACACAAGCCTC
ATCTCGGACCGCAGCGCCGTGTACGCGGCGGAACGATGGTCTTTGTCGGACCCGTCGGCGGACGTGAAGAACTAC
TGGGAGACGATGCATTTCCAGCGCCAAGGGTCGCCATCGCCTCAGTTCCGTCTTTTCAACATCGTCAACGGCATG
GTGGGCGCAGAAGCGCTTCCGTGTTCGACAGCGGGCAACGTGCCATTTTATAACGAGTTGAGACGCGTCCTCGTC
TCGGAGATGGACGGAGAGGCGCCGGAGCGGAGGCTGCATCCGGTCTTGTGCGCTGATCCGGGTACGCAGCATGAG
TTTTGCGGTGCTGCTCTGGGGCCCGACATGGCCTGCGTCTCCAAGGATCATACTGAAGGCGCCCAGTTCGGAGCG
GGCGTCTGCGGGGATTGCGCGCAGCACAGCGCGGAAATACTCTGCGACGCGTCCCAGGCCGGCATCACCAGCGCC
GAGATCAAGTCGATGCGTGCCTATCTCTGCGGCGACTGCTCGCAAGCCTGCCGGTCGCTCGAGAGCATCGGGCCC
AACCTCATCTGCCAAGGCGTCGCATCCATCTACGGCGCCACACAATGGACAGAACAAGGTCCCCTCACCCTCGAC
GCGGGCGGCCTAAGCATACGGGTCCATGCGCAAGCTTTCCCGGTGACGGGATGCAGCTGCGGCGCAAAGATGTTG
GACGCTCGCCTATGTCGTCAACATCGTCTCTTCTACGCCCGAAAGGCCATGGGACGGGTCGAGACGATGGGCAGA
TGGCGATTGGCTGCCTTTGCCGGTCGCGAGTGCTGTCCGACCTGTCTGGCGGATAAATCGGCCTTGGAGTCCGGC
CTGTCGACGGACTGGTCCGAGGGGCAGCCCGGAGCCTGGATCTGTATGCAGTGCAACGGCGCCGTCATCAACCAG
CCCCATCGAGGCCTCGTCCAAGGATGGGACACGTGGCTCGCTAACCCGTCCGCCGATTGGGCCGTCGTCGACGCT
GAGGATGGGCCTGGCGCCGACAGATCTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail