Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7099
Gene name
Locationscaffold_66:51139..52227
Strand-
Gene length (bp)1088
Transcript length (bp)1023
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00075 RNase_H RNase H 8.5E-37 190 335
PF01693 Cauli_VI Caulimovirus viroplasmin 2.2E-17 25 68
PF01693 Cauli_VI Caulimovirus viroplasmin 5.9E-16 83 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST8|RNH1_SCHPO Ribonuclease H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh1 PE=1 SV=1 79 335 7.0E-40
sp|O60930|RNH1_HUMAN Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 84 336 6.0E-33
sp|O70338|RNH1_MOUSE Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 84 336 4.0E-31
sp|Q5BK46|RNH1_RAT Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 84 336 6.0E-29
sp|Q04740|RNH1_YEAST Ribonuclease H OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH1 PE=1 SV=2 26 335 9.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST8|RNH1_SCHPO Ribonuclease H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh1 PE=1 SV=1 79 335 7.0E-40
sp|O60930|RNH1_HUMAN Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 84 336 6.0E-33
sp|O70338|RNH1_MOUSE Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 84 336 4.0E-31
sp|Q5BK46|RNH1_RAT Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 84 336 6.0E-29
sp|Q04740|RNH1_YEAST Ribonuclease H OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH1 PE=1 SV=2 26 335 9.0E-22
sp|A6VMP9|RNH_ACTSZ Ribonuclease H OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rnhA PE=3 SV=1 190 336 4.0E-21
sp|A1W6Q8|RNH_ACISJ Ribonuclease H OS=Acidovorax sp. (strain JS42) GN=rnhA PE=3 SV=1 188 336 4.0E-20
sp|Q65S82|RNH_MANSM Ribonuclease H OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnhA PE=3 SV=1 190 336 5.0E-20
sp|A3MZE1|RNH_ACTP2 Ribonuclease H OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnhA PE=3 SV=1 189 335 1.0E-19
sp|Q4KBI1|RNH_PSEF5 Ribonuclease H OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rnhA PE=3 SV=1 188 335 2.0E-19
sp|A4VLR0|RNH_PSEU5 Ribonuclease H OS=Pseudomonas stutzeri (strain A1501) GN=rnhA PE=3 SV=1 186 335 3.0E-19
sp|A1TQI7|RNH_ACIAC Ribonuclease H OS=Acidovorax citrulli (strain AAC00-1) GN=rnhA PE=3 SV=1 192 334 3.0E-19
sp|A6V705|RNH_PSEA7 Ribonuclease H OS=Pseudomonas aeruginosa (strain PA7) GN=rnhA PE=3 SV=1 185 334 4.0E-19
sp|A1U0U9|RNH_MARHV Ribonuclease H OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnhA PE=3 SV=1 192 336 6.0E-19
sp|Q9I2S9|RNH_PSEAE Ribonuclease HI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rnhA PE=3 SV=1 185 334 6.0E-19
sp|Q02KV8|RNH_PSEAB Ribonuclease H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rnhA PE=3 SV=1 185 334 6.0E-19
sp|B7VB62|RNH_PSEA8 Ribonuclease H OS=Pseudomonas aeruginosa (strain LESB58) GN=rnhA PE=3 SV=1 185 334 6.0E-19
sp|Q21YF6|RNH_RHOFT Ribonuclease H OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rnhA PE=3 SV=1 188 339 6.0E-19
sp|A4XU11|RNH_PSEMY Ribonuclease H OS=Pseudomonas mendocina (strain ymp) GN=rnhA PE=3 SV=1 185 335 8.0E-19
sp|A1AW38|RNH_RUTMC Ribonuclease H OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rnhA PE=3 SV=1 192 331 3.0E-18
sp|Q8XZ91|RNH_RALSO Ribonuclease H OS=Ralstonia solanacearum (strain GMI1000) GN=rnhA PE=3 SV=1 190 337 3.0E-18
sp|Q2Y8K1|RNH_NITMU Ribonuclease H OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rnhA PE=3 SV=1 182 339 5.0E-18
sp|C4LC60|RNH_TOLAT Ribonuclease H OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rnhA PE=3 SV=1 189 335 5.0E-18
sp|A1SS86|RNH_PSYIN Ribonuclease H OS=Psychromonas ingrahamii (strain 37) GN=rnhA PE=3 SV=2 190 336 5.0E-18
sp|Q5UPY1|RNH_MIMIV Probable ribonuclease H OS=Acanthamoeba polyphaga mimivirus GN=RNH1 PE=3 SV=1 201 336 5.0E-18
sp|Q3SIB2|RNH_THIDA Ribonuclease H OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rnhA PE=3 SV=1 186 334 5.0E-18
sp|P43807|RNH_HAEIN Ribonuclease HI OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnhA PE=3 SV=1 190 336 6.0E-18
sp|B8HPS9|RNH_CYAP4 Ribonuclease H OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rnhA PE=3 SV=1 188 331 6.0E-18
sp|Q60AW8|RNH_METCA Ribonuclease H OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rnhA PE=3 SV=1 184 334 7.0E-18
sp|B0TZ91|RNH_FRAP2 Ribonuclease H OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rnhA PE=3 SV=1 193 331 7.0E-18
sp|Q12MM4|RNH_SHEDO Ribonuclease H OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rnhA PE=3 SV=1 185 331 7.0E-18
sp|A4SPI4|RNH_AERS4 Ribonuclease H OS=Aeromonas salmonicida (strain A449) GN=rnhA PE=3 SV=1 189 331 7.0E-18
sp|Q9ZCK3|RNH_RICPR Ribonuclease HI OS=Rickettsia prowazekii (strain Madrid E) GN=rnhA PE=3 SV=1 192 334 8.0E-18
sp|Q7NYL8|RNH_CHRVO Ribonuclease H OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rnhA PE=3 SV=1 185 336 8.0E-18
sp|A0KIK4|RNH_AERHH Ribonuclease H OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnhA PE=3 SV=1 189 331 1.0E-17
sp|A4SXM6|RNH_POLSQ Ribonuclease H OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rnhA PE=3 SV=1 185 336 1.0E-17
sp|Q48KX6|RNH_PSE14 Ribonuclease H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rnhA PE=3 SV=1 188 335 1.0E-17
sp|A7HQX4|RNH_PARL1 Ribonuclease H OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rnhA PE=3 SV=1 185 334 1.0E-17
sp|Q68W20|RNH_RICTY Ribonuclease H OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rnhA PE=3 SV=1 192 334 1.0E-17
sp|Q1I7T4|RNH_PSEE4 Ribonuclease H OS=Pseudomonas entomophila (strain L48) GN=rnhA PE=3 SV=1 188 335 1.0E-17
sp|A1WFG9|RNH_VEREI Ribonuclease H OS=Verminephrobacter eiseniae (strain EF01-2) GN=rnhA PE=3 SV=1 188 334 1.0E-17
sp|A5UFU3|RNH_HAEIG Ribonuclease H OS=Haemophilus influenzae (strain PittGG) GN=rnhA PE=3 SV=1 187 336 2.0E-17
sp|Q4QP49|RNH_HAEI8 Ribonuclease H OS=Haemophilus influenzae (strain 86-028NP) GN=rnhA PE=3 SV=1 187 336 2.0E-17
sp|Q3KE77|RNH_PSEPF Ribonuclease H OS=Pseudomonas fluorescens (strain Pf0-1) GN=rnhA PE=3 SV=1 184 335 2.0E-17
sp|Q46Z81|RNH_CUPPJ Ribonuclease H OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rnhA PE=3 SV=1 192 334 2.0E-17
sp|Q7VM15|RNH_HAEDU Ribonuclease HI OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnhA PE=3 SV=1 190 335 3.0E-17
sp|Q2W9A9|RNH_MAGSA Ribonuclease H OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rnhA PE=3 SV=1 184 334 3.0E-17
sp|Q87MG2|RNH_VIBPA Ribonuclease HI OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnhA PE=3 SV=1 190 336 3.0E-17
sp|Q1RJL7|RNH_RICBR Ribonuclease H OS=Rickettsia bellii (strain RML369-C) GN=rnhA PE=3 SV=1 187 334 3.0E-17
sp|Q4ZVL1|RNH_PSEU2 Ribonuclease H OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnhA PE=3 SV=1 188 335 3.0E-17
sp|Q87YT0|RNH_PSESM Ribonuclease HI OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rnhA PE=3 SV=1 188 335 3.0E-17
sp|Q2IJL8|RNH_ANADE Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rnhA PE=3 SV=1 232 336 3.0E-17
sp|B0TRM1|RNH_SHEHH Ribonuclease H OS=Shewanella halifaxensis (strain HAW-EB4) GN=rnhA PE=3 SV=1 190 336 3.0E-17
sp|Q82XV8|RNH_NITEU Ribonuclease H OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rnhA PE=3 SV=1 189 335 3.0E-17
sp|Q1LL89|RNH_CUPMC Ribonuclease H OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rnhA PE=3 SV=1 190 334 4.0E-17
sp|A9W185|RNH_METEP Ribonuclease H OS=Methylobacterium extorquens (strain PA1) GN=rnhA PE=3 SV=1 192 334 4.0E-17
sp|P57813|RNH_PASMU Ribonuclease HI OS=Pasteurella multocida (strain Pm70) GN=rnhA PE=3 SV=1 187 336 5.0E-17
sp|B1JBN1|RNH_PSEPW Ribonuclease H OS=Pseudomonas putida (strain W619) GN=rnhA PE=3 SV=1 188 335 5.0E-17
sp|Q5NYP6|RNH_AROAE Ribonuclease H OS=Aromatoleum aromaticum (strain EbN1) GN=rnhA PE=3 SV=1 188 334 6.0E-17
sp|A4IYE6|RNH_FRATW Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|Q0BMB7|RNH_FRATO Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|A0Q6W0|RNH_FRATN Ribonuclease H OS=Francisella tularensis subsp. novicida (strain U112) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|B2SFV9|RNH_FRATM Ribonuclease H OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|Q2A3X6|RNH_FRATH Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|A7NBM9|RNH_FRATF Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rnhA PE=3 SV=1 193 331 7.0E-17
sp|Q14IN1|RNH_FRAT1 Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rnhA PE=3 SV=2 193 331 7.0E-17
sp|C3LPN8|RNH_VIBCM Ribonuclease H OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnhA PE=3 SV=1 190 336 8.0E-17
sp|Q9KPX8|RNH_VIBCH Ribonuclease HI OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnhA PE=3 SV=1 190 336 8.0E-17
sp|A5F633|RNH_VIBC3 Ribonuclease H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnhA PE=3 SV=1 190 336 8.0E-17
sp|Q0A753|RNH_ALKEH Ribonuclease H OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rnhA PE=3 SV=1 193 334 8.0E-17
sp|B4UMK8|RNH_ANASK Ribonuclease H OS=Anaeromyxobacter sp. (strain K) GN=rnhA PE=3 SV=1 232 331 9.0E-17
sp|Q2RPU6|RNH_RHORT Ribonuclease H OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rnhA PE=3 SV=1 182 335 9.0E-17
sp|Q4UN27|RNH_RICFE Ribonuclease H OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rnhA PE=3 SV=1 192 334 9.0E-17
sp|Q07705|RNH_MYCSM Ribonuclease H OS=Mycobacterium smegmatis GN=rnhA PE=3 SV=2 186 336 1.0E-16
sp|A0R3Q8|RNH_MYCS2 Ribonuclease H OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rnhA PE=3 SV=1 186 336 1.0E-16
sp|B8J731|RNH_ANAD2 Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rnhA PE=3 SV=1 232 336 1.0E-16
sp|Q92GL5|RNH_RICCN Ribonuclease HI OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rnhA PE=3 SV=2 192 334 1.0E-16
sp|A8GPT6|RNH_RICAH Ribonuclease H OS=Rickettsia akari (strain Hartford) GN=rnhA PE=3 SV=1 192 334 1.0E-16
sp|A5CEP5|RNH_ORITB Ribonuclease H OS=Orientia tsutsugamushi (strain Boryong) GN=rnhA PE=3 SV=1 190 334 2.0E-16
sp|A1VMW5|RNH_POLNA Ribonuclease H OS=Polaromonas naphthalenivorans (strain CJ2) GN=rnhA PE=3 SV=1 185 336 2.0E-16
sp|B7VIP1|RNH_VIBTL Ribonuclease H OS=Vibrio tasmaniensis (strain LGP32) GN=rnhA PE=3 SV=1 190 336 2.0E-16
sp|B1KHK0|RNH_SHEWM Ribonuclease H OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rnhA PE=3 SV=1 190 331 2.0E-16
sp|A8EXT7|RNH_RICCK Ribonuclease H OS=Rickettsia canadensis (strain McKiel) GN=rnhA PE=3 SV=1 192 334 2.0E-16
sp|Q0VQ76|RNH_ALCBS Ribonuclease H OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rnhA PE=3 SV=1 192 334 2.0E-16
sp|Q88FF5|RNH_PSEPK Ribonuclease HI OS=Pseudomonas putida (strain KT2440) GN=rnhA PE=3 SV=1 188 335 2.0E-16
sp|B0KN00|RNH_PSEPG Ribonuclease H OS=Pseudomonas putida (strain GB-1) GN=rnhA PE=3 SV=1 188 335 2.0E-16
sp|A5W169|RNH_PSEP1 Ribonuclease H OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnhA PE=3 SV=1 188 335 2.0E-16
sp|Q2G9E3|RNH_NOVAD Ribonuclease H OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rnhA PE=3 SV=1 190 331 3.0E-16
sp|Q1QW64|RNH_CHRSD Ribonuclease H OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rnhA PE=3 SV=1 190 331 3.0E-16
sp|Q2SJ45|RNH_HAHCH Ribonuclease H OS=Hahella chejuensis (strain KCTC 2396) GN=rnhA PE=3 SV=1 190 336 3.0E-16
sp|Q12B88|RNH_POLSJ Ribonuclease H OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rnhA PE=3 SV=1 192 336 3.0E-16
sp|Q1H190|RNH_METFK Ribonuclease H OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rnhA PE=3 SV=1 186 335 4.0E-16
sp|Q6G0C8|RNH_BARQU Ribonuclease H OS=Bartonella quintana (strain Toulouse) GN=rnhA PE=3 SV=1 185 331 4.0E-16
sp|A5CX29|RNH_VESOH Ribonuclease H OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rnhA PE=3 SV=1 192 331 4.0E-16
sp|C5BEV5|RNH_EDWI9 Ribonuclease H OS=Edwardsiella ictaluri (strain 93-146) GN=rnhA PE=3 SV=1 190 335 4.0E-16
sp|A8F2L0|RNH_RICM5 Ribonuclease H OS=Rickettsia massiliae (strain Mtu5) GN=rnhA PE=3 SV=2 192 334 4.0E-16
sp|A6SXA4|RNH_JANMA Ribonuclease H OS=Janthinobacterium sp. (strain Marseille) GN=rnhA PE=3 SV=1 188 337 5.0E-16
sp|Q0AE34|RNH_NITEC Ribonuclease H OS=Nitrosomonas eutropha (strain C91) GN=rnhA PE=3 SV=1 172 336 5.0E-16
sp|A0KXS6|RNH_SHESA Ribonuclease H OS=Shewanella sp. (strain ANA-3) GN=rnhA PE=3 SV=1 189 331 5.0E-16
sp|Q28V43|RNH_JANSC Ribonuclease H OS=Jannaschia sp. (strain CCS1) GN=rnhA PE=3 SV=1 190 334 5.0E-16
sp|A4T6Y5|RNH_MYCGI Ribonuclease H OS=Mycobacterium gilvum (strain PYR-GCK) GN=rnhA PE=3 SV=1 188 336 6.0E-16
sp|Q3IIS1|RNH_PSEHT Ribonuclease H OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rnhA PE=3 SV=1 187 331 7.0E-16
sp|Q7MII6|RNH_VIBVY Ribonuclease H OS=Vibrio vulnificus (strain YJ016) GN=rnhA PE=3 SV=1 190 331 7.0E-16
sp|Q8DBD5|RNH_VIBVU Ribonuclease HI OS=Vibrio vulnificus (strain CMCP6) GN=rnhA PE=3 SV=1 190 331 7.0E-16
sp|A7MY21|RNH_VIBCB Ribonuclease H OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rnhA PE=3 SV=1 190 336 9.0E-16
sp|A7HB50|RNH_ANADF Ribonuclease H OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rnhA PE=3 SV=1 182 336 1.0E-15
sp|A3QET0|RNH_SHELP Ribonuclease H OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rnhA PE=3 SV=1 190 338 1.0E-15
sp|Q0HI86|RNH_SHESM Ribonuclease H OS=Shewanella sp. (strain MR-4) GN=rnhA PE=3 SV=1 189 331 1.0E-15
sp|A1KV38|RNH_NEIMF Ribonuclease H OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rnhA PE=3 SV=1 192 335 1.0E-15
sp|Q0HUI2|RNH_SHESR Ribonuclease H OS=Shewanella sp. (strain MR-7) GN=rnhA PE=3 SV=1 189 331 1.0E-15
sp|B0T025|RNH_CAUSK Ribonuclease H OS=Caulobacter sp. (strain K31) GN=rnhA PE=3 SV=1 190 334 1.0E-15
sp|Q9JYE5|RNH_NEIMB Ribonuclease HI OS=Neisseria meningitidis serogroup B (strain MC58) GN=rnhA PE=3 SV=1 192 335 2.0E-15
sp|A6U6V5|RNH_SINMW Ribonuclease H OS=Sinorhizobium medicae (strain WSM419) GN=rnhA PE=3 SV=1 192 334 2.0E-15
sp|Q2KV56|RNH_BORA1 Ribonuclease H OS=Bordetella avium (strain 197N) GN=rnhA PE=3 SV=1 183 335 2.0E-15
sp|Q0K8W6|RNH_CUPNH Ribonuclease H OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rnhA PE=3 SV=1 190 336 3.0E-15
sp|Q081L4|RNH_SHEFN Ribonuclease H OS=Shewanella frigidimarina (strain NCIMB 400) GN=rnhA PE=3 SV=1 190 336 3.0E-15
sp|Q7WCJ8|RNH_BORBR Ribonuclease H OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rnhA PE=3 SV=1 190 336 3.0E-15
sp|Q9JTD9|RNH_NEIMA Ribonuclease HI OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rnhA PE=3 SV=1 192 335 4.0E-15
sp|Q5F7K9|RNH_NEIG1 Ribonuclease H OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rnhA PE=3 SV=1 192 335 4.0E-15
sp|Q7VRX8|RNH_BORPE Ribonuclease H OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rnhA PE=3 SV=1 190 334 4.0E-15
sp|Q6G4C3|RNH_BARHE Ribonuclease H OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnhA PE=3 SV=1 187 331 4.0E-15
sp|Q92RG0|RNH_RHIME Ribonuclease H OS=Rhizobium meliloti (strain 1021) GN=rnhA PE=3 SV=1 190 334 4.0E-15
sp|A4W6V4|RNH_ENT38 Ribonuclease H OS=Enterobacter sp. (strain 638) GN=rnhA PE=3 SV=1 190 331 5.0E-15
sp|Q9A341|RNH_CAUCR Ribonuclease HI OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rnhA PE=3 SV=1 190 336 5.0E-15
sp|B8H4W7|RNH_CAUCN Ribonuclease H OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rnhA PE=3 SV=1 190 336 5.0E-15
sp|Q2KBL2|RNH_RHIEC Ribonuclease H OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rnhA PE=3 SV=1 192 334 6.0E-15
sp|Q7VQB6|RNH_BLOFL Ribonuclease H OS=Blochmannia floridanus GN=rnhA PE=3 SV=1 190 336 6.0E-15
sp|Q8EE30|RNH_SHEON Ribonuclease HI OS=Shewanella oneidensis (strain MR-1) GN=rnhA PE=1 SV=1 189 331 6.0E-15
sp|B5EMD8|RNH_ACIF5 Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rnhA PE=3 SV=1 187 333 6.0E-15
sp|B7J4E2|RNH_ACIF2 Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rnhA PE=3 SV=1 187 333 6.0E-15
sp|A5EAL2|RNH_BRASB Ribonuclease H OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rnhA PE=3 SV=1 190 337 6.0E-15
sp|Q3SP51|RNH_NITWN Ribonuclease H OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rnhA PE=3 SV=1 182 337 7.0E-15
sp|A1WXD7|RNH_HALHL Ribonuclease H OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rnhA PE=3 SV=1 189 334 7.0E-15
sp|A1S6T0|RNH_SHEAM Ribonuclease H OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rnhA PE=3 SV=1 190 336 8.0E-15
sp|Q55801|RNH_SYNY3 Ribonuclease HI OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rnhA PE=3 SV=1 184 332 1.0E-14
sp|A4FMU3|RNH_SACEN Ribonuclease H OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rnhA PE=3 SV=1 184 334 1.0E-14
sp|Q8DM24|RNH_THEEB Ribonuclease H OS=Thermosynechococcus elongatus (strain BP-1) GN=rnhA PE=3 SV=1 192 333 1.0E-14
sp|Q83GM3|RNH_TROWT Ribonuclease H OS=Tropheryma whipplei (strain Twist) GN=rnhA PE=3 SV=1 194 336 1.0E-14
sp|Q83HK9|RNH_TROW8 Ribonuclease H OS=Tropheryma whipplei (strain TW08/27) GN=rnhA PE=3 SV=1 194 336 1.0E-14
sp|A4Z216|RNH_BRASO Ribonuclease H OS=Bradyrhizobium sp. (strain ORS278) GN=rnhA PE=3 SV=1 185 337 1.0E-14
sp|Q31H49|RNH_THICR Ribonuclease H OS=Thiomicrospira crunogena (strain XCL-2) GN=rnhA PE=3 SV=1 190 331 1.0E-14
sp|B6J5V1|RNH_COXB1 Ribonuclease H OS=Coxiella burnetii (strain CbuK_Q154) GN=rnhA PE=3 SV=1 182 334 1.0E-14
sp|Q3J7D4|RNH_NITOC Ribonuclease H OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rnhA PE=3 SV=1 188 331 1.0E-14
sp|A9KGQ0|RNH_COXBN Ribonuclease H OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|B6J1Y7|RNH_COXB2 Ribonuclease H OS=Coxiella burnetii (strain CbuG_Q212) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|Q1QH30|RNH_NITHX Ribonuclease H OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rnhA PE=3 SV=1 182 337 2.0E-14
sp|B7JVG1|RNH_CYAP8 Ribonuclease H OS=Cyanothece sp. (strain PCC 8801) GN=rnhA PE=3 SV=1 192 336 2.0E-14
sp|A1RK75|RNH_SHESW Ribonuclease H OS=Shewanella sp. (strain W3-18-1) GN=rnhA PE=3 SV=1 185 331 2.0E-14
sp|A4Y6C1|RNH_SHEPC Ribonuclease H OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rnhA PE=3 SV=1 185 331 2.0E-14
sp|B3Q6U1|RNH_RHOPT Ribonuclease H OS=Rhodopseudomonas palustris (strain TIE-1) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|Q6N1Y3|RNH_RHOPA Ribonuclease H OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|Q83EK3|RNH_COXBU Ribonuclease H OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|A9NB52|RNH_COXBR Ribonuclease H OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rnhA PE=3 SV=1 182 334 2.0E-14
sp|Q15TA7|RNH_PSEA6 Ribonuclease H OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rnhA PE=3 SV=1 190 331 2.0E-14
sp|A3PMR3|RNH_RHOS1 Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rnhA PE=3 SV=1 190 334 2.0E-14
sp|A4WNV1|RNH_RHOS5 Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rnhA PE=3 SV=1 190 334 2.0E-14
sp|Q0C3M1|RNH_HYPNA Ribonuclease H OS=Hyphomonas neptunium (strain ATCC 15444) GN=rnhA PE=3 SV=1 185 335 2.0E-14
sp|A5EXP9|RNH_DICNV Ribonuclease H OS=Dichelobacter nodosus (strain VCS1703A) GN=rnhA PE=3 SV=1 189 333 3.0E-14
sp|B6JJ39|RNH_OLICO Ribonuclease H OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rnhA PE=3 SV=1 182 334 3.0E-14
sp|A1B840|RNH_PARDP Ribonuclease H OS=Paracoccus denitrificans (strain Pd 1222) GN=rnhA PE=3 SV=1 188 334 3.0E-14
sp|Q5QZL3|RNH_IDILO Ribonuclease H OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rnhA PE=3 SV=1 185 331 3.0E-14
sp|A8LLC1|RNH_DINSH Ribonuclease H OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rnhA PE=3 SV=1 190 334 3.0E-14
sp|Q89UU3|RNH_BRADU Ribonuclease H OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rnhA PE=3 SV=1 185 331 3.0E-14
sp|Q2J0F8|RNH_RHOP2 Ribonuclease H OS=Rhodopseudomonas palustris (strain HaA2) GN=rnhA PE=3 SV=1 192 331 4.0E-14
sp|B4R8T3|RNH_PHEZH Ribonuclease H OS=Phenylobacterium zucineum (strain HLK1) GN=rnhA PE=3 SV=1 192 334 4.0E-14
sp|A8FUS8|RNH_SHESH Ribonuclease H OS=Shewanella sediminis (strain HAW-EB3) GN=rnhA PE=3 SV=1 190 336 4.0E-14
sp|A9L0F2|RNH_SHEB9 Ribonuclease H OS=Shewanella baltica (strain OS195) GN=rnhA PE=3 SV=1 189 336 5.0E-14
sp|A6WMW8|RNH_SHEB8 Ribonuclease H OS=Shewanella baltica (strain OS185) GN=rnhA PE=3 SV=1 189 336 5.0E-14
sp|A3D440|RNH_SHEB5 Ribonuclease H OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rnhA PE=3 SV=1 189 336 5.0E-14
sp|B8E599|RNH_SHEB2 Ribonuclease H OS=Shewanella baltica (strain OS223) GN=rnhA PE=3 SV=1 189 336 5.0E-14
sp|Q1MKH6|RNH_RHIL3 Ribonuclease H OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rnhA PE=3 SV=1 192 334 5.0E-14
sp|Q2ND39|RNH_ERYLH Ribonuclease H OS=Erythrobacter litoralis (strain HTCC2594) GN=rnhA PE=3 SV=1 190 337 5.0E-14
sp|Q87C76|RNH_XYLFT Ribonuclease HI OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rnhA PE=3 SV=1 189 331 5.0E-14
sp|Q131J2|RNH_RHOPS Ribonuclease H OS=Rhodopseudomonas palustris (strain BisB5) GN=rnhA PE=3 SV=1 192 331 5.0E-14
sp|Q16AK0|RNH_ROSDO Ribonuclease H OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rnhA PE=3 SV=1 190 334 6.0E-14
sp|Q5H426|RNH_XANOR Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnhA PE=3 SV=1 190 331 6.0E-14
sp|Q2P6Y2|RNH_XANOM Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rnhA PE=3 SV=1 190 331 6.0E-14
sp|Q2LWY9|RNH_SYNAS Ribonuclease H OS=Syntrophus aciditrophicus (strain SB) GN=rnhA PE=3 SV=1 192 335 6.0E-14
sp|Q3BWP3|RNH_XANC5 Ribonuclease H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rnhA PE=3 SV=1 190 331 7.0E-14
sp|Q985W1|RNH_RHILO Ribonuclease H OS=Rhizobium loti (strain MAFF303099) GN=rnhA PE=3 SV=1 190 334 7.0E-14
sp|Q8UHA7|RNH_AGRFC Ribonuclease H OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rnhA PE=3 SV=1 192 334 7.0E-14
sp|A8AKR0|RNH_CITK8 Ribonuclease H OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnhA PE=3 SV=1 190 331 7.0E-14
sp|B2S2V0|RNH_TREPS Ribonuclease H OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rnhA PE=3 SV=1 190 336 8.0E-14
sp|O83372|RNH_TREPA Ribonuclease H OS=Treponema pallidum (strain Nichols) GN=rnhA PE=3 SV=1 190 336 8.0E-14
sp|Q73K21|RNH_TREDE Ribonuclease H OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnhA PE=3 SV=1 190 336 8.0E-14
sp|Q0RJ31|RNH_FRAAA Ribonuclease H OS=Frankia alni (strain ACN14a) GN=rnhA PE=3 SV=1 192 336 9.0E-14
sp|A9IQR5|RNH_BART1 Ribonuclease H OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rnhA PE=3 SV=1 184 331 9.0E-14
sp|Q5E3G5|RNH_VIBF1 Ribonuclease H OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rnhA PE=3 SV=1 190 331 1.0E-13
sp|Q9PBI6|RNH_XYLFA Ribonuclease HI OS=Xylella fastidiosa (strain 9a5c) GN=rnhA PE=3 SV=2 190 331 1.0E-13
sp|A1URX4|RNH_BARBK Ribonuclease H OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rnhA PE=3 SV=1 185 331 1.0E-13
sp|Q5LNJ2|RNH_RUEPO Ribonuclease H OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rnhA PE=3 SV=1 190 336 1.0E-13
sp|Q72IE1|RNH_THET2 Ribonuclease H OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rnhA PE=3 SV=1 182 336 1.0E-13
sp|Q2NVF9|RNH_SODGM Ribonuclease H OS=Sodalis glossinidius (strain morsitans) GN=rnhA PE=3 SV=1 192 331 2.0E-13
sp|Q3A827|RNH_PELCD Ribonuclease H OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rnhA PE=3 SV=1 184 331 2.0E-13
sp|P29253|RNH_THET8 Ribonuclease H OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rnhA PE=1 SV=2 182 336 2.0E-13
sp|Q01RW8|RNH_SOLUE Ribonuclease H OS=Solibacter usitatus (strain Ellin6076) GN=rnhA PE=3 SV=1 190 336 2.0E-13
sp|A1VFS4|RNH_DESVV Ribonuclease H OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rnhA PE=3 SV=1 190 331 2.0E-13
sp|Q72E89|RNH_DESVH Ribonuclease H OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rnhA PE=3 SV=1 190 331 2.0E-13
sp|O69014|RNH_ZYMMO Ribonuclease H OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnhA PE=3 SV=1 183 331 2.0E-13
sp|P0A2B9|RNH_SALTY Ribonuclease HI OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|P0A2C0|RNH_SALTI Ribonuclease HI OS=Salmonella typhi GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B4TYH0|RNH_SALSV Ribonuclease H OS=Salmonella schwarzengrund (strain CVM19633) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B5BDW5|RNH_SALPK Ribonuclease H OS=Salmonella paratyphi A (strain AKU_12601) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|A9MZ19|RNH_SALPB Ribonuclease H OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|Q5PFD8|RNH_SALPA Ribonuclease H OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B4SV39|RNH_SALNS Ribonuclease H OS=Salmonella newport (strain SL254) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B4TK85|RNH_SALHS Ribonuclease H OS=Salmonella heidelberg (strain SL476) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B5R5L3|RNH_SALG2 Ribonuclease H OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B5R449|RNH_SALEP Ribonuclease H OS=Salmonella enteritidis PT4 (strain P125109) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B5FJ58|RNH_SALDC Ribonuclease H OS=Salmonella dublin (strain CT_02021853) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|Q57SZ6|RNH_SALCH Ribonuclease H OS=Salmonella choleraesuis (strain SC-B67) GN=rnhA PE=3 SV=2 189 331 2.0E-13
sp|A9MPF1|RNH_SALAR Ribonuclease H OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B5F8X2|RNH_SALA4 Ribonuclease H OS=Salmonella agona (strain SL483) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|A4G7G3|RNH_HERAR Ribonuclease H OS=Herminiimonas arsenicoxydans GN=rnhA PE=3 SV=1 188 336 2.0E-13
sp|C0Q6N2|RNH_SALPC Ribonuclease H OS=Salmonella paratyphi C (strain RKS4594) GN=rnhA PE=3 SV=1 189 331 2.0E-13
sp|B8DIU7|RNH_DESVM Ribonuclease H OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rnhA PE=3 SV=1 190 331 2.0E-13
sp|Q47FN9|RNH_DECAR Ribonuclease H OS=Dechloromonas aromatica (strain RCB) GN=rnhA PE=3 SV=1 185 334 3.0E-13
sp|Q0AMI4|RNH_MARMM Ribonuclease H OS=Maricaulis maris (strain MCS10) GN=rnhA PE=3 SV=1 190 334 3.0E-13
sp|Q1GDG1|RNH_RUEST Ribonuclease H OS=Ruegeria sp. (strain TM1040) GN=rnhA PE=3 SV=1 190 334 4.0E-13
sp|B1JR46|RNH_YERPY Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|Q667M7|RNH_YERPS Ribonuclease H OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|A4TL54|RNH_YERPP Ribonuclease H OS=Yersinia pestis (strain Pestoides F) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|Q1CFI6|RNH_YERPN Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|A9R0G0|RNH_YERPG Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|Q8ZH30|RNH_YERPE Ribonuclease HI OS=Yersinia pestis GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|B2KAC9|RNH_YERPB Ribonuclease H OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|Q1CAJ5|RNH_YERPA Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|A7FFK7|RNH_YERP3 Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnhA PE=3 SV=1 190 335 4.0E-13
sp|B5Y1G2|RNH_KLEP3 Ribonuclease H OS=Klebsiella pneumoniae (strain 342) GN=rnhA PE=3 SV=1 189 331 5.0E-13
sp|A6T512|RNH_KLEP7 Ribonuclease H OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnhA PE=3 SV=1 190 331 5.0E-13
sp|Q493H7|RNH_BLOPB Ribonuclease H OS=Blochmannia pennsylvanicus (strain BPEN) GN=rnhA PE=3 SV=1 190 336 5.0E-13
sp|B3EMT1|RNH_CHLPB Ribonuclease H OS=Chlorobium phaeobacteroides (strain BS1) GN=rnhA PE=3 SV=1 192 336 7.0E-13
sp|A1AT66|RNH_PELPD Ribonuclease H OS=Pelobacter propionicus (strain DSM 2379) GN=rnhA PE=3 SV=1 190 331 8.0E-13
sp|P59434|RNH_BUCBP Ribonuclease H OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rnhA PE=3 SV=1 190 337 9.0E-13
sp|Q8PBX8|RNH_XANCP Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rnhA PE=3 SV=1 190 331 1.0E-12
sp|Q4URM3|RNH_XANC8 Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rnhA PE=3 SV=1 190 331 1.0E-12
sp|B0K1A7|RNH_THEPX Ribonuclease H OS=Thermoanaerobacter sp. (strain X514) GN=rnhA PE=3 SV=1 188 336 1.0E-12
sp|B0K9M0|RNH_THEP3 Ribonuclease H OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rnhA PE=3 SV=1 188 336 1.0E-12
sp|Q8PNH8|RNH_XANAC Ribonuclease H OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rnhA PE=3 SV=1 190 331 1.0E-12
sp|A4XKQ3|RNH_CALS8 Ribonuclease H OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rnhA PE=3 SV=1 192 331 1.0E-12
sp|A7MI34|RNH_CROS8 Ribonuclease H OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnhA PE=3 SV=1 190 331 1.0E-12
sp|Q8RA67|RNH_CALS4 Ribonuclease H OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rnhA PE=3 SV=1 185 336 1.0E-12
sp|Q5PBQ8|RNH_ANAMM Ribonuclease H OS=Anaplasma marginale (strain St. Maries) GN=rnhA PE=3 SV=2 182 331 2.0E-12
sp|A6WWG8|RNH_OCHA4 Ribonuclease H OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rnhA PE=3 SV=1 190 334 2.0E-12
sp|Q30X61|RNH_DESAG Ribonuclease H OS=Desulfovibrio alaskensis (strain G20) GN=rnhA PE=3 SV=1 192 331 2.0E-12
sp|A7GAG3|RNH_CLOBL Ribonuclease H OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rnhA PE=3 SV=1 192 331 2.0E-12
sp|A5HYU6|RNH_CLOBH Ribonuclease H OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rnhA PE=3 SV=1 192 331 2.0E-12
sp|A7FR34|RNH_CLOB1 Ribonuclease H OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rnhA PE=3 SV=1 192 331 2.0E-12
sp|Q6D1V7|RNH_PECAS Ribonuclease H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rnhA PE=3 SV=1 190 331 2.0E-12
sp|B4S5K2|RNH_PROA2 Ribonuclease H OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rnhA PE=3 SV=1 192 336 3.0E-12
sp|Q74BH0|RNH_GEOSL Ribonuclease H OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rnhA PE=3 SV=1 190 333 3.0E-12
sp|Q115G0|RNH_TRIEI Ribonuclease H OS=Trichodesmium erythraeum (strain IMS101) GN=rnhA PE=3 SV=1 190 336 3.0E-12
sp|C6DC65|RNH_PECCP Ribonuclease H OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rnhA PE=3 SV=1 190 331 4.0E-12
sp|B2VHJ5|RNH_ERWT9 Ribonuclease H OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnhA PE=3 SV=1 190 335 5.0E-12
sp|B4EUG3|RNH_PROMH Ribonuclease H OS=Proteus mirabilis (strain HI4320) GN=rnhA PE=3 SV=1 190 336 5.0E-12
sp|A4SFZ9|RNH_CHLPM Ribonuclease H OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rnhA PE=3 SV=1 187 333 5.0E-12
sp|P66674|RNH_BRUSU Ribonuclease HI OS=Brucella suis biovar 1 (strain 1330) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|B0CKG2|RNH_BRUSI Ribonuclease H OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|A5VP47|RNH_BRUO2 Ribonuclease H OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|P66673|RNH_BRUME Ribonuclease HI OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|Q57EP4|RNH_BRUAB Ribonuclease H OS=Brucella abortus biovar 1 (strain 9-941) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|Q2YMI3|RNH_BRUA2 Ribonuclease H OS=Brucella abortus (strain 2308) GN=rnhA PE=3 SV=1 190 334 5.0E-12
sp|A4J7B3|RNH_DESRM Ribonuclease H OS=Desulfotomaculum reducens (strain MI-1) GN=rnhA PE=3 SV=1 190 336 6.0E-12
sp|Q7VDY9|RNH_PROMA Ribonuclease H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnhA PE=3 SV=1 180 336 7.0E-12
sp|A7ZWF6|RNH_ECOHS Ribonuclease H OS=Escherichia coli O9:H4 (strain HS) GN=rnhA PE=3 SV=1 190 331 7.0E-12
sp|B7LHC0|RNH_ECO55 Ribonuclease H OS=Escherichia coli (strain 55989 / EAEC) GN=rnhA PE=3 SV=1 190 331 7.0E-12
sp|Q11KC5|RNH_CHESB Ribonuclease H OS=Chelativorans sp. (strain BNC1) GN=rnhA PE=3 SV=1 190 334 7.0E-12
sp|A1JKB1|RNH_YERE8 Ribonuclease H OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnhA PE=3 SV=1 190 335 8.0E-12
sp|Q0TLC3|RNH_ECOL5 Ribonuclease H OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7UJB0|RNH_ECO27 Ribonuclease H OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|Q3Z5E9|RNH_SHISS Ribonuclease H OS=Shigella sonnei (strain Ss046) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|P0A7Y7|RNH_SHIFL Ribonuclease HI OS=Shigella flexneri GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|Q32JP9|RNH_SHIDS Ribonuclease H OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|Q325T2|RNH_SHIBS Ribonuclease H OS=Shigella boydii serotype 4 (strain Sb227) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B2U352|RNH_SHIB3 Ribonuclease H OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7LW89|RNH_ESCF3 Ribonuclease H OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B1LHM3|RNH_ECOSM Ribonuclease H OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B6HZS7|RNH_ECOSE Ribonuclease H OS=Escherichia coli (strain SE11) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7N876|RNH_ECOLU Ribonuclease H OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|P0A7Y4|RNH_ECOLI Ribonuclease HI OS=Escherichia coli (strain K12) GN=rnhA PE=1 SV=1 190 331 8.0E-12
sp|B1IPU4|RNH_ECOLC Ribonuclease H OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|P0A7Y5|RNH_ECOL6 Ribonuclease HI OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B1XD78|RNH_ECODH Ribonuclease H OS=Escherichia coli (strain K12 / DH10B) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|C4ZRV1|RNH_ECOBW Ribonuclease H OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7M213|RNH_ECO8A Ribonuclease H OS=Escherichia coli O8 (strain IAI1) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7MQ23|RNH_ECO81 Ribonuclease H OS=Escherichia coli O81 (strain ED1a) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7NKW4|RNH_ECO7I Ribonuclease H OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B5Z0I8|RNH_ECO5E Ribonuclease H OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|P0A7Y6|RNH_ECO57 Ribonuclease HI OS=Escherichia coli O157:H7 GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|B7MBJ0|RNH_ECO45 Ribonuclease H OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|A7ZHV1|RNH_ECO24 Ribonuclease H OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnhA PE=3 SV=1 190 331 8.0E-12
sp|Q5ZVQ7|RNH_LEGPH Ribonuclease H OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rnhA PE=3 SV=1 190 334 9.0E-12
sp|A5IBM5|RNH_LEGPC Ribonuclease H OS=Legionella pneumophila (strain Corby) GN=rnhA PE=3 SV=1 190 334 9.0E-12
sp|Q5X5I2|RNH_LEGPA Ribonuclease H OS=Legionella pneumophila (strain Paris) GN=rnhA PE=3 SV=1 190 334 9.0E-12
sp|A8GA77|RNH_SERP5 Ribonuclease H OS=Serratia proteamaculans (strain 568) GN=rnhA PE=3 SV=1 190 331 9.0E-12
sp|Q3B2H0|RNH_CHLL7 Ribonuclease H OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rnhA PE=3 SV=2 190 331 1.0E-11
sp|C0R2X2|RNH_WOLWR Ribonuclease H OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rnhA PE=3 SV=1 186 331 1.0E-11
sp|B6EJV2|RNH_ALISL Ribonuclease H OS=Aliivibrio salmonicida (strain LFI1238) GN=rnhA PE=3 SV=1 190 331 2.0E-11
sp|Q73I74|RNH_WOLPM Ribonuclease H OS=Wolbachia pipientis wMel GN=rnhA PE=3 SV=1 192 331 2.0E-11
sp|Q7N807|RNH_PHOLL Ribonuclease H OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnhA PE=3 SV=1 190 331 2.0E-11
sp|Q17XJ7|RNH_HELAH Ribonuclease H OS=Helicobacter acinonychis (strain Sheeba) GN=rnhA PE=3 SV=1 190 331 2.0E-11
sp|Q8GF77|RNH_PHOLU Ribonuclease H OS=Photorhabdus luminescens GN=rnhA PE=3 SV=1 190 331 2.0E-11
sp|B3QM41|RNH_CHLP8 Ribonuclease H OS=Chlorobaculum parvum (strain NCIB 8327) GN=rnhA PE=3 SV=1 187 331 4.0E-11
sp|Q5FUH9|RNH_GLUOX Ribonuclease H OS=Gluconobacter oxydans (strain 621H) GN=rnhA PE=3 SV=1 183 334 4.0E-11
sp|Q5WWW5|RNH_LEGPL Ribonuclease H OS=Legionella pneumophila (strain Lens) GN=rnhA PE=3 SV=1 190 334 4.0E-11
sp|Q1CTK9|RNH_HELPH Ribonuclease H OS=Helicobacter pylori (strain HPAG1) GN=rnhA PE=3 SV=1 190 331 5.0E-11
sp|A9KLJ9|RNH_CLOPH Ribonuclease H OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rnhA PE=3 SV=1 190 335 6.0E-11
sp|Q0AV47|RNH_SYNWW Ribonuclease H OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rnhA PE=3 SV=1 192 331 6.0E-11
sp|Q0BQX7|RNH_GRABC Ribonuclease H OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rnhA PE=3 SV=1 188 333 8.0E-11
sp|P56120|RNH_HELPY Ribonuclease HI OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnhA PE=3 SV=1 190 331 1.0E-10
sp|A5G5F6|RNH_GEOUR Ribonuclease H OS=Geobacter uraniireducens (strain Rf4) GN=rnhA PE=3 SV=1 190 331 1.0E-10
sp|Q2GDA1|RNH_NEOSM Ribonuclease H OS=Neorickettsia sennetsu (strain Miyayama) GN=rnhA PE=3 SV=1 192 331 3.0E-10
sp|Q7UF86|RNH_RHOBA Ribonuclease H OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rnhA PE=3 SV=1 190 332 4.0E-10
sp|A1BE10|RNH_CHLPD Ribonuclease H OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rnhA PE=3 SV=1 192 336 5.0E-10
sp|A6QCI9|RNH_SULNB Ribonuclease H OS=Sulfurovum sp. (strain NBC37-1) GN=rnhA PE=3 SV=1 182 331 8.0E-10
sp|Q9X7R6|RNH_STRCO Ribonuclease HI OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rnhA PE=3 SV=2 232 337 8.0E-10
sp|Q39X47|RNH_GEOMG Ribonuclease H OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rnhA PE=3 SV=1 232 335 9.0E-10
sp|A2C030|RNH_PROM1 Ribonuclease H OS=Prochlorococcus marinus (strain NATL1A) GN=rnhA PE=3 SV=1 232 337 9.0E-10
sp|Q2RKU0|RNH_MOOTA Ribonuclease H OS=Moorella thermoacetica (strain ATCC 39073) GN=rnhA PE=3 SV=1 190 328 9.0E-10
sp|A5FZ26|RNH_ACICJ Ribonuclease H OS=Acidiphilium cryptum (strain JF-5) GN=rnhA PE=3 SV=1 182 332 1.0E-09
sp|B3EH35|RNH_CHLL2 Ribonuclease H OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rnhA PE=3 SV=1 190 336 1.0E-09
sp|Q3YR62|RNH_EHRCJ Ribonuclease H OS=Ehrlichia canis (strain Jake) GN=rnhA PE=3 SV=1 192 331 1.0E-09
sp|Q46HH3|RNH_PROMT Ribonuclease H OS=Prochlorococcus marinus (strain NATL2A) GN=rnhA PE=3 SV=1 232 337 1.0E-09
sp|Q9ZLH3|RNH_HELPJ Ribonuclease HI OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnhA PE=3 SV=1 190 331 3.0E-09
sp|Q2GHJ9|RNH_EHRCR Ribonuclease H OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rnhA PE=3 SV=1 192 331 3.0E-09
sp|Q3APT0|RNH_CHLCH Ribonuclease H OS=Chlorobium chlorochromatii (strain CaD3) GN=rnhA PE=3 SV=1 190 331 4.0E-09
sp|Q5FG88|RNH_EHRRG Ribonuclease H OS=Ehrlichia ruminantium (strain Gardel) GN=rnhA PE=3 SV=2 192 331 4.0E-09
sp|A3DD79|RNH_CLOTH Ribonuclease H OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rnhA PE=3 SV=1 192 332 1.0E-08
sp|Q1LT02|RNH_BAUCH Ribonuclease H OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnhA PE=3 SV=1 190 331 2.0E-08
sp|A0LGJ7|RNH_SYNFM Ribonuclease H OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rnhA PE=3 SV=1 174 331 3.0E-08
sp|Q9KEI9|RNH1_BACHD Ribonuclease H OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rnhA PE=1 SV=1 25 91 5.0E-07
sp|P19028|POL_FIVSD Pol polyprotein OS=Feline immunodeficiency virus (strain San Diego) GN=pol PE=3 SV=1 193 330 4.0E-06
sp|Q5HSF7|RNH_CAMJR Ribonuclease H OS=Campylobacter jejuni (strain RM1221) GN=rnhA PE=3 SV=1 190 335 8.0E-06
sp|A1W1N8|RNH_CAMJJ Ribonuclease H OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rnhA PE=3 SV=1 190 335 8.0E-06
sp|Q9PM39|RNH_CAMJE Ribonuclease HI OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rnhA PE=1 SV=1 190 335 8.0E-06
sp|A8FNU8|RNH_CAMJ8 Ribonuclease H OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rnhA PE=3 SV=1 190 335 8.0E-06
sp|A7H185|RNH_CAMC5 Ribonuclease H OS=Campylobacter curvus (strain 525.92) GN=rnhA PE=3 SV=1 190 331 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0004523 RNA-DNA hybrid ribonuclease activity Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0004540 ribonuclease activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0004519 endonuclease activity No
GO:0004521 endoribonuclease activity No
GO:0003674 molecular_function No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7099
MNKKRPALAAVPNPSKKRRTDNLPKFYAVKAGFKPGVYMAYSDCQRQTAGFKGAVFKSFTSRDDAEAFVAGKKVA
ADAGEPDKFYAVAVGSPTGIYTDWSDAAAAIKGVKGPKYKRFGSRAEAVAYIKQFGSRETIEALGDMGYANGDED
SDEEDEDDDDEDDEDEDDDDPLQLSGGKKRVMAASSEDMLKIYTDGSSLANGKVGCRAGVGVYFGDGDVRNVSER
LEGELQTNQRAELMAMLRALQIAPRSQTVQIVSDSQYSINCVTQWAVGWKLKDWMTATGEKVKNQDIIRAVLDKI
DERTLAGANTYFHWVKGHSSDRGNQAADRLAVRGAKIGFV
Coding >Ophio5|7099
ATGAACAAGAAGCGGCCTGCACTGGCGGCGGTGCCCAATCCGTCCAAGAAGAGGAGGACGGACAACCTGCCAAAA
TTTTACGCCGTCAAGGCTGGTTTCAAGCCTGGCGTTTACATGGCATATTCCGACTGCCAGCGGCAGACGGCCGGC
TTCAAGGGTGCTGTTTTCAAGTCGTTTACGTCGCGCGATGATGCAGAAGCCTTTGTGGCGGGAAAAAAGGTGGCG
GCCGACGCCGGAGAGCCGGACAAGTTCTACGCCGTGGCCGTGGGCAGCCCGACGGGCATCTACACCGACTGGAGC
GACGCTGCGGCCGCCATCAAGGGTGTCAAGGGCCCCAAGTACAAGCGCTTCGGCTCGCGCGCCGAGGCCGTTGCC
TACATCAAGCAGTTTGGCAGCAGGGAGACCATCGAGGCTCTGGGCGACATGGGTTACGCCAACGGCGACGAGGAC
AGTGACGAAGAAGACGAAGACGACGACGACGAAGACGACGAAGACGAAGATGACGACGACCCTCTTCAACTGTCG
GGCGGCAAAAAAAGGGTCATGGCGGCGTCGTCGGAGGACATGCTCAAGATATACACCGACGGCAGCAGCCTCGCC
AACGGCAAGGTGGGCTGCCGGGCCGGAGTCGGCGTCTACTTCGGCGACGGCGACGTGCGCAACGTGTCGGAGCGG
CTCGAGGGCGAGCTGCAGACGAACCAGCGGGCCGAGCTGATGGCGATGCTGCGGGCGCTGCAGATTGCGCCGCGG
TCGCAGACGGTGCAGATCGTCAGCGACAGCCAGTACTCGATCAACTGCGTGACGCAGTGGGCCGTTGGCTGGAAG
CTCAAGGACTGGATGACGGCGACGGGCGAAAAGGTCAAGAATCAAGACATCATCCGGGCCGTGCTTGACAAGATT
GACGAGCGCACCCTGGCCGGCGCCAACACGTACTTTCACTGGGTCAAGGGCCACTCTTCGGATCGCGGAAACCAG
GCGGCTGATCGGCTGGCGGTCCGGGGCGCCAAGATTGGCTTTGTC
Transcript >Ophio5|7099
ATGAACAAGAAGCGGCCTGCACTGGCGGCGGTGCCCAATCCGTCCAAGAAGAGGAGGACGGACAACCTGCCAAAA
TTTTACGCCGTCAAGGCTGGTTTCAAGCCTGGCGTTTACATGGCATATTCCGACTGCCAGCGGCAGACGGCCGGC
TTCAAGGGTGCTGTTTTCAAGTCGTTTACGTCGCGCGATGATGCAGAAGCCTTTGTGGCGGGAAAAAAGGTGGCG
GCCGACGCCGGAGAGCCGGACAAGTTCTACGCCGTGGCCGTGGGCAGCCCGACGGGCATCTACACCGACTGGAGC
GACGCTGCGGCCGCCATCAAGGGTGTCAAGGGCCCCAAGTACAAGCGCTTCGGCTCGCGCGCCGAGGCCGTTGCC
TACATCAAGCAGTTTGGCAGCAGGGAGACCATCGAGGCTCTGGGCGACATGGGTTACGCCAACGGCGACGAGGAC
AGTGACGAAGAAGACGAAGACGACGACGACGAAGACGACGAAGACGAAGATGACGACGACCCTCTTCAACTGTCG
GGCGGCAAAAAAAGGGTCATGGCGGCGTCGTCGGAGGACATGCTCAAGATATACACCGACGGCAGCAGCCTCGCC
AACGGCAAGGTGGGCTGCCGGGCCGGAGTCGGCGTCTACTTCGGCGACGGCGACGTGCGCAACGTGTCGGAGCGG
CTCGAGGGCGAGCTGCAGACGAACCAGCGGGCCGAGCTGATGGCGATGCTGCGGGCGCTGCAGATTGCGCCGCGG
TCGCAGACGGTGCAGATCGTCAGCGACAGCCAGTACTCGATCAACTGCGTGACGCAGTGGGCCGTTGGCTGGAAG
CTCAAGGACTGGATGACGGCGACGGGCGAAAAGGTCAAGAATCAAGACATCATCCGGGCCGTGCTTGACAAGATT
GACGAGCGCACCCTGGCCGGCGCCAACACGTACTTTCACTGGGTCAAGGGCCACTCTTCGGATCGCGGAAACCAG
GCGGCTGATCGGCTGGCGGTCCGGGGCGCCAAGATTGGCTTTGTCTGA
Gene >Ophio5|7099
ATGAACAAGAAGCGGCCTGCACTGGCGGCGGTGCCCAATCCGTCCAAGAAGAGGAGGACGGACAACCTGCCAAAA
TTTTACGCCGTCAAGGCTGGTTTCAAGCCTGGCGTTTACATGGCATATTCCGACTGCCAGCGGCAGACGGCCGGC
TTCAAGGGTGCTGTTTGTGAGTGCTGAGACTGCTGGCCCTCGATTGCGGCCTTAAGAGCTGACGAGGTCTGGGAT
TGACAGTCAAGTCGTTTACGTCGCGCGATGATGCAGAAGCCTTTGTGGCGGGAAAAAAGGTGGCGGCCGACGCCG
GAGAGCCGGACAAGTTCTACGCCGTGGCCGTGGGCAGCCCGACGGGCATCTACACCGACTGGAGCGACGCTGCGG
CCGCCATCAAGGGTGTCAAGGGCCCCAAGTACAAGCGCTTCGGCTCGCGCGCCGAGGCCGTTGCCTACATCAAGC
AGTTTGGCAGCAGGGAGACCATCGAGGCTCTGGGCGACATGGGTTACGCCAACGGCGACGAGGACAGTGACGAAG
AAGACGAAGACGACGACGACGAAGACGACGAAGACGAAGATGACGACGACCCTCTTCAACTGTCGGGCGGCAAAA
AAAGGGTCATGGCGGCGTCGTCGGAGGACATGCTCAAGATATACACCGACGGCAGCAGCCTCGCCAACGGCAAGG
TGGGCTGCCGGGCCGGAGTCGGCGTCTACTTCGGCGACGGCGACGTGCGCAACGTGTCGGAGCGGCTCGAGGGCG
AGCTGCAGACGAACCAGCGGGCCGAGCTGATGGCGATGCTGCGGGCGCTGCAGATTGCGCCGCGGTCGCAGACGG
TGCAGATCGTCAGCGACAGCCAGTACTCGATCAACTGCGTGACGCAGTGGGCCGTTGGCTGGAAGCTCAAGGACT
GGATGACGGCGACGGGCGAAAAGGTCAAGAATCAAGACATCATCCGGGCCGTGCTTGACAAGATTGACGAGCGCA
CCCTGGCCGGCGCCAACACGTACTTTCACTGGGTCAAGGGCCACTCTTCGGATCGCGGAAACCAGGCGGCTGATC
GGCTGGCGGTCCGGGGCGCCAAGATTGGCTTTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail