Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7098
Gene name
Locationscaffold_66:47947..49770
Strand-
Gene length (bp)1823
Transcript length (bp)1650
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 1.1E-44 23 460

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 7 465 6.0E-83
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 12 468 9.0E-79
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 12 465 1.0E-78
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 15 465 2.0E-78
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 18 467 2.0E-60

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0015298 solute:cation antiporter activity No
GO:0005575 cellular_component No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 123 145 22
3 150 172 22
4 198 220 22
5 235 257 22
6 277 296 19
7 350 372 22
8 393 415 22
9 442 464 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 53.31 29.20 77.42
CcL In ants, during behavior modification 1246.34 49.29 2443.40
CcD In ants, recently dead 76.46 37.46 115.47

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.128079 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7098
MGHGTTIWDVPLRPSNFNVSLALLGGFVSLFGLVSFLVKENFYLSEALISLLVGVAFGPKGTNWLRPREYAECLW
EGVDAAECRSNLDGVTMAFSRLVLGVQLVLAGVQLPSRYLWTERRSLLLLVGPGMAAMWLATSGLVWIVLRPRSL
LHALAVGACVTPTDPVLSAVIVKGKFADQNIPPELQDLVIAESGTNDGLGYPFLFFALYLIKFIGAGAGVGGEEA
GGVADAVGLWFGFTWAYTIALGIAYGALVGLLGKSLLHWAEGRNYVDRESFLVFAISLALFVVGTCGLLGTDDVL
ACFIAGNTFTWDDWFRLRTKDDSLQPTVDMLLNVTVFLWYGASLPWDSFVHNGVPGLTIGRLVALGVLVLVLRRL
PWVFAMRRWIHQIEGVRHAVFVGFFGPIGVSAVFYIFVAVDFIDDYLSDADGVPRSDVVHLAETIRIVVWFLVVC
SVVVHGLTIPIGKLGYLAPRFGRALGGRSPSREPLLITRQRRVSSLRKWLGRKTGSVDSGIIPREPNDFEDWDTG
SGLSSPCRPSSAVSSGHGEGVARA
Coding >Ophio5|7098
ATGGGCCACGGCACCACCATTTGGGACGTGCCGCTACGGCCGTCCAACTTCAACGTCAGCCTGGCCCTGCTCGGC
GGCTTCGTCTCGCTCTTTGGTCTCGTTTCCTTTCTCGTCAAGGAGAATTTTTATCTCTCGGAAGCGCTCATCTCC
CTTCTCGTCGGCGTCGCCTTCGGCCCCAAAGGCACAAACTGGCTCCGGCCTCGCGAGTACGCCGAATGTCTCTGG
GAGGGCGTAGACGCAGCCGAGTGTCGATCCAACCTGGACGGCGTCACCATGGCCTTTTCGCGCCTCGTTCTGGGC
GTCCAACTTGTCCTGGCCGGCGTACAGCTTCCCAGTCGATATCTCTGGACCGAGCGTCGCTCTTTGCTACTCCTC
GTCGGTCCCGGTATGGCGGCCATGTGGTTGGCCACGAGCGGCCTCGTCTGGATTGTGCTTCGTCCTCGGAGCCTT
CTTCATGCTTTGGCTGTGGGGGCCTGTGTGACGCCGACGGATCCGGTGCTTTCGGCCGTCATCGTCAAGGGCAAG
TTTGCCGATCAGAATATCCCGCCCGAGTTGCAGGATTTGGTCATTGCCGAGTCGGGGACGAATGACGGCTTGGGC
TATCCCTTTCTGTTCTTTGCTCTCTATCTCATCAAGTTTATCGGCGCCGGTGCCGGTGTCGGAGGAGAAGAAGCG
GGAGGCGTGGCCGATGCCGTCGGTCTCTGGTTCGGCTTCACCTGGGCCTATACCATCGCCCTCGGCATCGCCTAC
GGCGCCTTGGTCGGCCTGCTCGGCAAGTCGCTTCTTCACTGGGCCGAAGGGCGCAACTACGTCGATCGCGAGAGC
TTCCTCGTCTTCGCCATCTCGCTTGCCCTCTTTGTCGTCGGCACCTGCGGTCTACTGGGTACCGACGATGTCCTA
GCCTGCTTCATCGCCGGAAACACCTTCACCTGGGACGACTGGTTCCGGCTACGGACCAAGGATGACTCGCTGCAG
CCGACGGTCGACATGCTGCTCAACGTCACCGTCTTCTTGTGGTACGGTGCCTCGCTGCCGTGGGACAGCTTCGTG
CACAACGGCGTGCCGGGCCTCACCATCGGTCGTCTCGTCGCCTTGGGAGTTCTCGTGCTGGTGCTGAGACGGCTG
CCGTGGGTGTTTGCCATGCGCAGATGGATTCATCAGATCGAGGGGGTGCGTCATGCCGTCTTTGTCGGCTTCTTT
GGGCCCATTGGCGTTTCTGCCGTCTTCTACATCTTCGTCGCCGTCGACTTCATCGACGATTACTTGAGTGACGCC
GACGGCGTACCGAGGAGCGACGTCGTTCATCTGGCCGAGACGATACGCATCGTCGTCTGGTTCCTCGTCGTCTGC
AGCGTCGTCGTCCACGGACTGACCATCCCCATCGGCAAGCTCGGATACCTGGCGCCGCGCTTCGGGCGAGCCTTG
GGCGGCCGGAGCCCTAGCCGTGAGCCTCTACTCATCACGCGTCAGAGGAGGGTCTCGAGCCTCAGGAAGTGGCTC
GGCCGCAAGACGGGCAGTGTCGATTCCGGCATCATCCCCCGCGAGCCCAACGATTTCGAAGACTGGGATACCGGC
TCGGGCTTGAGCTCGCCGTGTCGGCCGTCCAGCGCCGTCTCGTCGGGCCATGGCGAGGGTGTCGCTCGTGCT
Transcript >Ophio5|7098
ATGGGCCACGGCACCACCATTTGGGACGTGCCGCTACGGCCGTCCAACTTCAACGTCAGCCTGGCCCTGCTCGGC
GGCTTCGTCTCGCTCTTTGGTCTCGTTTCCTTTCTCGTCAAGGAGAATTTTTATCTCTCGGAAGCGCTCATCTCC
CTTCTCGTCGGCGTCGCCTTCGGCCCCAAAGGCACAAACTGGCTCCGGCCTCGCGAGTACGCCGAATGTCTCTGG
GAGGGCGTAGACGCAGCCGAGTGTCGATCCAACCTGGACGGCGTCACCATGGCCTTTTCGCGCCTCGTTCTGGGC
GTCCAACTTGTCCTGGCCGGCGTACAGCTTCCCAGTCGATATCTCTGGACCGAGCGTCGCTCTTTGCTACTCCTC
GTCGGTCCCGGTATGGCGGCCATGTGGTTGGCCACGAGCGGCCTCGTCTGGATTGTGCTTCGTCCTCGGAGCCTT
CTTCATGCTTTGGCTGTGGGGGCCTGTGTGACGCCGACGGATCCGGTGCTTTCGGCCGTCATCGTCAAGGGCAAG
TTTGCCGATCAGAATATCCCGCCCGAGTTGCAGGATTTGGTCATTGCCGAGTCGGGGACGAATGACGGCTTGGGC
TATCCCTTTCTGTTCTTTGCTCTCTATCTCATCAAGTTTATCGGCGCCGGTGCCGGTGTCGGAGGAGAAGAAGCG
GGAGGCGTGGCCGATGCCGTCGGTCTCTGGTTCGGCTTCACCTGGGCCTATACCATCGCCCTCGGCATCGCCTAC
GGCGCCTTGGTCGGCCTGCTCGGCAAGTCGCTTCTTCACTGGGCCGAAGGGCGCAACTACGTCGATCGCGAGAGC
TTCCTCGTCTTCGCCATCTCGCTTGCCCTCTTTGTCGTCGGCACCTGCGGTCTACTGGGTACCGACGATGTCCTA
GCCTGCTTCATCGCCGGAAACACCTTCACCTGGGACGACTGGTTCCGGCTACGGACCAAGGATGACTCGCTGCAG
CCGACGGTCGACATGCTGCTCAACGTCACCGTCTTCTTGTGGTACGGTGCCTCGCTGCCGTGGGACAGCTTCGTG
CACAACGGCGTGCCGGGCCTCACCATCGGTCGTCTCGTCGCCTTGGGAGTTCTCGTGCTGGTGCTGAGACGGCTG
CCGTGGGTGTTTGCCATGCGCAGATGGATTCATCAGATCGAGGGGGTGCGTCATGCCGTCTTTGTCGGCTTCTTT
GGGCCCATTGGCGTTTCTGCCGTCTTCTACATCTTCGTCGCCGTCGACTTCATCGACGATTACTTGAGTGACGCC
GACGGCGTACCGAGGAGCGACGTCGTTCATCTGGCCGAGACGATACGCATCGTCGTCTGGTTCCTCGTCGTCTGC
AGCGTCGTCGTCCACGGACTGACCATCCCCATCGGCAAGCTCGGATACCTGGCGCCGCGCTTCGGGCGAGCCTTG
GGCGGCCGGAGCCCTAGCCGTGAGCCTCTACTCATCACGCGTCAGAGGAGGGTCTCGAGCCTCAGGAAGTGGCTC
GGCCGCAAGACGGGCAGTGTCGATTCCGGCATCATCCCCCGCGAGCCCAACGATTTCGAAGACTGGGATACCGGC
TCGGGCTTGAGCTCGCCGTGTCGGCCGTCCAGCGCCGTCTCGTCGGGCCATGGCGAGGGTGTCGCTCGTGCTTGA
Gene >Ophio5|7098
ATGGGCCACGGCACCACCATTTGGGACGTGCCGCTACGGCCGTCCAACTTCAACGTCAGCCTGGCCCTGCTCGGC
GGCTTCGTCTCGCTCTTTGGTCTCGTTTCCTTTCTCGTCAAGGAGAATTTTTATCTCTCGGAAGCGCGTGAGTAA
ACATTTTTTGACCCTTTTTTTGGGGGGGTTTTTTTTTCCCATATACTCACCCTTTTATTCCCGGGGGAGGGGGAG
AAAAAAAAGTCATCTCCCTTCTCGTCGGCGTCGCCTTCGGCCCCAAAGGCACAAACTGGCTCCGGCCTCGCGAGT
ACGCCGAATGTCTCTGGGAGGGCGTAGACGCAGCCGAGTGTCGATCCAACCTGGACGGCGTCACCATGGCCTTTT
CGCGCCTCGTTCTGGGCGTCCAACTTGTCCTGGCCGGCGTACAGCTTCCCAGTCGATATCTCTGGACCGAGCGTC
GCTCTTTGCTACTCCTCGTCGGTCCCGGTATGGCGGCCATGTGGTTGGCCACGAGCGGCCTCGTCTGGATTGTGC
TTCGTCCTCGGAGCCTTCTTCATGCTTTGGCTGTGGGGGCCTGTGTGACGCCGACGGATCCGGTGCTTTCGGCCG
TCATCGTCAAGGGCAAGTTTGCCGATCAGAATATCCCGCCCGAGTTGCAGGATTTGGTCATTGCCGAGTCGGGGA
CGAATGACGGCTTGGGCTATCCCTTTCTGTTCTTTGCTCTCTATCTCATCAAGTTTATCGGCGCCGGTGCCGGTG
TCGGAGGAGAAGAAGCGGGAGGCGTGGCCGATGCCGTCGGTCTCTGGTTCGGCTTCACCTGGGCCTATACCATCG
CCCTCGGCATCGCCTACGGCGCCTTGGTCGGCCTGCTCGGCAAGTCGCTTCTTCACTGGGCCGAAGGGCGCAACT
ACGTCGATCGCGAGAGCTTCCTCGTCTTCGCCATCTCGCTTGCCCTCTTTGTCGTCGGCACCTGCGGTCTACTGG
GTACCGACGATGTCCTAGCCTGCTTCATCGCCGGAAACACCTTCACCTGGGACGACTGGTTCCGGCTACGGACCA
AGGATGACTCGCTGCAGCCGACGGTCGACATGCTGCTCAACGTCACCGTCTTCTTGTGGTACGGTGCCTCGCTGC
CGTGGGACAGCTTCGTGCACAACGGCGTGCCGGGCCTCACCATCGGTCGTCTCGTCGCCTTGGGAGTTCTCGTGC
TGGTGCTGAGACGGCTGCCGTGGGTGTTTGCCATGCGCAGATGGATTCATCAGATCGAGGGGGTGCGTCATGCCG
TCTTTGTCGGCTTCTTTGGGCCCATTGGCGTTTCTGCCGTCTTCTACATCTTCGTCGCCGTCGACTTCATCGACG
ATTACTTGAGTGACGCCGACGGCGTACCGAGGAGCGACGTCGTTCATCTGGCCGAGACGATACGCATCGTCGTCT
GGTTCCTCGTCGTCTGCAGCGTCGTGAGTTTGGTCCTATAGCAAAAATTCATTCATTCCCTGAGGCGCTCGCTAA
TCACACCCCCCCTTTTTTTTTTGGTTCAGGTCGTCCACGGACTGACCATCCCCATCGGCAAGCTCGGATACCTGG
CGCCGCGCTTCGGGCGAGCCTTGGGCGGCCGGAGCCCTAGCCGTGAGCCTCTACTCATCACGCGTCAGAGGAGGG
TCTCGAGCCTCAGGAAGTGGCTCGGCCGCAAGACGGGCAGTGTCGATTCCGGCATCATCCCCCGCGAGCCCAACG
ATTTCGAAGACTGGGATACCGGCTCGGGCTTGAGCTCGCCGTGTCGGCCGTCCAGCGCCGTCTCGTCGGGCCATG
GCGAGGGTGTCGCTCGTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail