Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7092
Gene name
Locationscaffold_66:27252..27752
Strand-
Gene length (bp)500
Transcript length (bp)375
Coding sequence length (bp)372
Protein length (aa) 124

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09649 CHZ Histone chaperone domain CHZ 4.0E-18 66 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7ER98|CHZ1_SCLS1 Histone H2A.Z-specific chaperone chz1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=chz1 PE=3 SV=1 25 102 9.0E-08
sp|Q1E4L8|CHZ1_COCIM Histone H2A.Z-specific chaperone CHZ1 OS=Coccidioides immitis (strain RS) GN=CHZ1 PE=3 SV=2 25 99 3.0E-07
sp|Q2GNS7|CHZ1_CHAGB Histone H2A.Z-specific chaperone CHZ1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHZ1 PE=3 SV=2 1 102 4.0E-07
sp|A6SMQ7|CHZ1_BOTFB Histone H2A.Z-specific chaperone chz1 OS=Botryotinia fuckeliana (strain B05.10) GN=chz1 PE=3 SV=1 25 102 2.0E-06
sp|A7TR90|CHZ1_VANPO Histone H2A.Z-specific chaperone CHZ1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHZ1 PE=3 SV=1 66 102 6.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7ER98|CHZ1_SCLS1 Histone H2A.Z-specific chaperone chz1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=chz1 PE=3 SV=1 25 102 9.0E-08
sp|Q1E4L8|CHZ1_COCIM Histone H2A.Z-specific chaperone CHZ1 OS=Coccidioides immitis (strain RS) GN=CHZ1 PE=3 SV=2 25 99 3.0E-07
sp|Q2GNS7|CHZ1_CHAGB Histone H2A.Z-specific chaperone CHZ1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHZ1 PE=3 SV=2 1 102 4.0E-07
sp|A6SMQ7|CHZ1_BOTFB Histone H2A.Z-specific chaperone chz1 OS=Botryotinia fuckeliana (strain B05.10) GN=chz1 PE=3 SV=1 25 102 2.0E-06
sp|A7TR90|CHZ1_VANPO Histone H2A.Z-specific chaperone CHZ1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHZ1 PE=3 SV=1 66 102 6.0E-06
sp|Q2UBH8|CHZ1_ASPOR Histone H2A.Z-specific chaperone chz1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=chz1 PE=3 SV=1 14 99 8.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4352 0.8036 0.0651 0.0992 0.0333 0.0056 0.1131 0.021 0.1493 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3260
Ophiocordyceps australis map64 (Brazil) OphauB2|7667
Ophiocordyceps camponoti-floridani Ophcf2|00485
Ophiocordyceps camponoti-rufipedis Ophun1|2054
Ophiocordyceps kimflemingae Ophio5|7092 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7092
MADKSDTLPAKSAAVEEPGADTESKGKGKAVAEDVPKEEVMEEDDDDEDDDDEEEEEAEDNAEGGEEEDGMEEID
LKNIVEGGRRTRGAKIDFAKAAEENPADEEDEEDDDDFKPPPEDTSMSG
Coding >Ophio5|7092
ATGGCGGACAAGAGCGACACACTCCCTGCCAAGTCCGCTGCGGTTGAGGAGCCCGGCGCTGATACTGAGAGTAAG
GGCAAGGGCAAGGCTGTTGCCGAAGATGTCCCCAAGGAGGAGGTCATGGAGGAAGACGATGACGACGAGGATGAT
GACGACGAGGAGGAGGAAGAGGCCGAGGACAACGCCGAGGGTGGCGAAGAAGAGGACGGCATGGAGGAGATTGAC
CTTAAGAACATCGTCGAGGGCGGCCGCCGCACCCGCGGCGCCAAGATCGACTTCGCCAAGGCCGCCGAGGAAAAT
CCTGCCGACGAGGAAGATGAGGAAGACGACGACGACTTTAAGCCGCCGCCCGAGGACACCTCCATGTCCGGA
Transcript >Ophio5|7092
ATGGCGGACAAGAGCGACACACTCCCTGCCAAGTCCGCTGCGGTTGAGGAGCCCGGCGCTGATACTGAGAGTAAG
GGCAAGGGCAAGGCTGTTGCCGAAGATGTCCCCAAGGAGGAGGTCATGGAGGAAGACGATGACGACGAGGATGAT
GACGACGAGGAGGAGGAAGAGGCCGAGGACAACGCCGAGGGTGGCGAAGAAGAGGACGGCATGGAGGAGATTGAC
CTTAAGAACATCGTCGAGGGCGGCCGCCGCACCCGCGGCGCCAAGATCGACTTCGCCAAGGCCGCCGAGGAAAAT
CCTGCCGACGAGGAAGATGAGGAAGACGACGACGACTTTAAGCCGCCGCCCGAGGACACCTCCATGTCCGGATAG
Gene >Ophio5|7092
ATGGCGGACAAGAGCGACACACTCCCTGCCAAGTCCGCTGCGGTTGAGGAGCCCGGCGCTGATACTGAGAGTAAG
GGCAAGGGCAAGGCTGTTGCCGAAGATGTCCCCAAGGAGGAGGTCATGGAGGAAGACGATGACGACGAGGATGAT
GACGACGAGGAGGAGGAAGAGGCCGAGGACGTAAGTCATATCCCGTTTTCCTCACCTGTTTTTTTTTTTCAGACC
AGCAGCTGACGTGCCGTCGCAGAACGCCGAGGGTGGTAAATATTCCCTAACCAAGTCGCCATCGCTCGTGGCTGC
TGCTGACGGTGAGAGCAGGCGAAGAAGAGGACGGCATGGAGGAGATTGACCTTAAGAACATCGTCGAGGGCGGCC
GCCGCACCCGCGGCGCCAAGATCGACTTCGCCAAGGCCGCCGAGGAAAATCCTGCCGACGAGGAAGATGAGGAAG
ACGACGACGACTTTAAGCCGCCGCCCGAGGACACCTCCATGTCCGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail