Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7088
Gene name
Locationscaffold_66:14194..21627
Strand-
Gene length (bp)7433
Transcript length (bp)6507
Coding sequence length (bp)6504
Protein length (aa) 2168

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01645 Glu_synthase Conserved region in glutamate synthase 1.1E-153 923 1293
PF00310 GATase_2 Glutamine amidotransferases class-II 8.3E-59 161 360
PF00310 GATase_2 Glutamine amidotransferases class-II 1.9E-61 379 517
PF04898 Glu_syn_central Glutamate synthase central domain 1.4E-108 578 862
PF01493 GXGXG GXGXG motif 5.8E-85 1374 1560
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 7.4E-22 1806 2117
PF14691 Fer4_20 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster 1.4E-20 1683 1792
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-08 1810 1843
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.9E-05 1807 1878
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.4E-06 1816 1843
PF03486 HI0933_like HI0933-like protein 2.0E-05 1807 1841
PF00890 FAD_binding_2 FAD binding domain 1.8E-04 1808 1842

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1XDB2|GLTB_PYRYE Ferredoxin-dependent glutamate synthase OS=Pyropia yezoensis GN=gltB PE=3 SV=1 157 1599 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 130 2157 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 157 1599 0.0E+00
sp|Q05755|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1 152 1607 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 151 1614 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1XDB2|GLTB_PYRYE Ferredoxin-dependent glutamate synthase OS=Pyropia yezoensis GN=gltB PE=3 SV=1 157 1599 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 130 2157 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 157 1599 0.0E+00
sp|Q05755|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1 152 1607 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 151 1614 0.0E+00
sp|P55038|GLTS_SYNY3 Ferredoxin-dependent glutamate synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltS PE=1 SV=2 157 1599 0.0E+00
sp|Q06434|GLTB_ANTSP Ferredoxin-dependent glutamate synthase OS=Antithamnion sp. GN=gltB PE=3 SV=1 157 1599 0.0E+00
sp|P51375|GLTB_PORPU Ferredoxin-dependent glutamate synthase OS=Porphyra purpurea GN=gltB PE=3 SV=1 142 1599 0.0E+00
sp|Q9T0P4|GLTB2_ARATH Ferredoxin-dependent glutamate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=GLU2 PE=1 SV=2 138 1599 0.0E+00
sp|Q9ZNZ7|GLTB1_ARATH Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLU1 PE=1 SV=3 135 1616 0.0E+00
sp|Q69RJ0|GLTB_ORYSJ Ferredoxin-dependent glutamate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLU PE=2 SV=2 157 1617 0.0E+00
sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1 144 2141 0.0E+00
sp|Q12680|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2 129 2156 0.0E+00
sp|Q43155|GLTB_SPIOL Ferredoxin-dependent glutamate synthase, chloroplastic OS=Spinacia oleracea GN=FdGOGAT PE=1 SV=3 161 1599 0.0E+00
sp|Q0DG35|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2 150 2143 0.0E+00
sp|Q9LV03|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=2 SV=2 144 2143 0.0E+00
sp|Q0JKD0|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1 150 2143 0.0E+00
sp|P55037|GLTB_SYNY3 Ferredoxin-dependent glutamate synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltB PE=1 SV=1 146 1614 0.0E+00
sp|P96218|GLTB_MYCTU Glutamate synthase [NADPH] large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltB PE=1 SV=3 146 1611 0.0E+00
sp|P39812|GLTA_BACSU Glutamate synthase [NADPH] large chain OS=Bacillus subtilis (strain 168) GN=gltA PE=2 SV=3 145 1620 0.0E+00
sp|P23225|GLTB_MAIZE Ferredoxin-dependent glutamate synthase, chloroplastic OS=Zea mays GN=GLSF PE=1 SV=1 157 1617 0.0E+00
sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 1661 2148 5.0E-165
sp|P9WN19|GLTD_MYCTU Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltD PE=1 SV=1 1666 2148 5.0E-137
sp|P9WN18|GLTD_MYCTO Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gltD PE=3 SV=1 1666 2148 5.0E-137
sp|P09832|GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) GN=gltD PE=1 SV=3 1667 2134 3.0E-73
sp|Q05756|GLTD_AZOBR Glutamate synthase [NADPH] small chain OS=Azospirillum brasilense GN=gltD PE=1 SV=3 1666 2134 5.0E-71
sp|P37127|AEGA_ECOLI Protein AegA OS=Escherichia coli (strain K12) GN=aegA PE=3 SV=2 1660 2137 6.0E-62
sp|Q08258|GLTB_HORVU Ferredoxin-dependent glutamate synthase (Fragment) OS=Hordeum vulgare PE=1 SV=2 161 541 5.0E-60
sp|B9KBQ2|AGLUS_THENN Archaeal-type glutamate synthase [NADPH] OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gltB PE=3 SV=1 994 1306 1.0E-57
sp|B1L993|AGLUS_THESQ Archaeal-type glutamate synthase [NADPH] OS=Thermotoga sp. (strain RQ2) GN=gltB PE=3 SV=1 994 1306 2.0E-57
sp|Q9WYM8|AGLUS_THEMA Archaeal-type glutamate synthase [NADPH] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltB PE=3 SV=1 994 1306 2.0E-57
sp|O29309|AGLUS_ARCFU Archaeal glutamate synthase [NADPH] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltB PE=3 SV=1 979 1306 4.0E-55
sp|Q46820|YGFT_ECOLI Uncharacterized protein YgfT OS=Escherichia coli (strain K12) GN=ygfT PE=3 SV=2 1671 2137 2.0E-52
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 1678 2143 6.0E-52
sp|Q3Z7F6|AGLUS_DEHM1 Archaeal-type glutamate synthase [NADPH] OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gltB PE=3 SV=1 978 1301 1.0E-51
sp|Q58746|AGLUS_METJA Archaeal glutamate synthase [NADPH] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1351 PE=3 SV=1 995 1324 2.0E-51
sp|O08340|GLTD_RHOSH Putative glutamate synthase [NADPH] small chain OS=Rhodobacter sphaeroides GN=gltD PE=3 SV=1 1744 2143 4.0E-46
sp|Q74FU5|SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrB PE=1 SV=1 1625 2143 7.0E-27
sp|D7AF64|SFRB_GEOSK NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrB PE=3 SV=1 1625 2143 7.0E-27
sp|O34849|YERD_BACSU Glutamate synthase large subunit-like protein YerD OS=Bacillus subtilis (strain 168) GN=yerD PE=3 SV=1 994 1263 6.0E-24
sp|P76440|PRET_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) GN=preT PE=1 SV=1 1702 2146 4.0E-22
sp|Q8X645|PRET_ECO57 NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli O157:H7 GN=preT PE=3 SV=1 1702 2146 1.0E-21
sp|Q55FT1|DPYD_DICDI Dihydropyrimidine dehydrogenase [NADP(+)] OS=Dictyostelium discoideum GN=pyd1 PE=2 SV=1 1701 2152 1.0E-21
sp|Q8Z5A6|PRET_SALTI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT homolog OS=Salmonella typhi GN=preT PE=3 SV=1 1702 1975 5.0E-21
sp|Q46811|YGFK_ECOLI Uncharacterized protein YgfK OS=Escherichia coli (strain K12) GN=ygfK PE=3 SV=1 1708 2137 7.0E-21
sp|Q8XD75|YGFK_ECO57 Uncharacterized protein YgfK OS=Escherichia coli O157:H7 GN=ygfK PE=3 SV=1 1708 2137 2.0E-20
sp|Q8ZNL8|PRET_SALTY NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=preT PE=3 SV=1 1702 1975 3.0E-20
sp|Q6NYG8|DPYD_DANRE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Danio rerio GN=dpyd PE=2 SV=1 1702 2142 2.0E-18
sp|Q5R895|DPYD_PONAB Dihydropyrimidine dehydrogenase [NADP(+)] OS=Pongo abelii GN=DPYD PE=2 SV=1 1702 2142 4.0E-18
sp|Q8CHR6|DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus GN=Dpyd PE=1 SV=1 1702 2142 1.0E-17
sp|Q28007|DPYD_BOVIN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Bos taurus GN=DPYD PE=1 SV=1 1702 2142 1.0E-17
sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens GN=DPYD PE=1 SV=2 1702 2142 7.0E-17
sp|O89000|DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Dpyd PE=2 SV=1 1702 2142 1.0E-16
sp|Q28943|DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa GN=DPYD PE=1 SV=1 1702 2142 1.0E-15
sp|A8XKG6|DPYD_CAEBR Probable dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis briggsae GN=dpyd-1 PE=3 SV=2 1702 1975 6.0E-14
sp|Q18164|DPYD_CAEEL Dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis elegans GN=dpyd-1 PE=3 SV=2 1702 1975 3.0E-13
sp|O87392|GLXD_RHIME Glutamate synthase large subunit-like protein OS=Rhizobium meliloti (strain 1021) GN=glxD PE=3 SV=2 1041 1265 2.0E-09
sp|Q8W3L1|MFDR_ARATH NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=MFDR PE=1 SV=1 1808 1943 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0008150 biological_process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0003824 catalytic activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7088
MHKQHFLPFRFRNHQVVHWPINGPSWSTIVASWPHRKEALACAQLTQTEGWSPEAIRSRAAFGAALTYNFFSNFA
ASPLPLLRDRRPQSPAAARLLPVPVSRESSPSMGLLEDFDDRQISIEAEKHAYQPYEYQTENNASWAGALPVKQG
LYDPSYEKDACGVGFACHIKGKASHKIVSDARNLLCNMTHRGAVGSDARDGDGAGVMTSIPHWFFIKNFEREQDV
KLPPPGQYAVGNLFFKPDEETFAESKRQLEDVAESLGLRVLGWRRPPVDSTLLGPAAKSREPFIAQPFVVLADAY
GPGDAPRLTDPDDFDERLFERQLYVLRKRATHTIGLKNWFYLCSLSNKNIVYKGQLAPVQSTPDSRPTLFPRGTA
PSRCNWMRAREGVMQSDVFKDELEMMYPIVEESGSDSAAFDNVLELLTINGVLSLPEAVMLMVPEAWQGNEHMDP
HKAAFYEWAACQMEPWDGPALFTFADGRYCGANLDRNGLRPCRFYIMDDDRIICASEVGTIPVEPDTAGRIIDDK
ELKEAVASRHDFRAWLDRELIVMPSILEALNESSVDLEAKPDAALLQEDPLLLAFGYTFEQVSLLLAPMAADEKE
ALGSMGNDAPLACLTQAPRLLYDYFRQLFAQVTNPPIDPIRESIVMSLECYVGPQGNLLEMDPSQCGRLMLPSPI
LSIPEFNAIVNMSSIYPKWTVKTIDLTYPKSQGVQGYLNHLDEICNEATTAIEARDRIIVLSDRRTSADRLAVSA
VLASAMVHHHLVSNKWRSMVALVVETAEAREVHHMCVLLGYGTDAVNPYLAMECILKLNREGLIKRKITDEALIR
NYKHSCDGGILKVMSKMGISTLASYKGAQIFEALGLDEEVVDRCFRGTASRIQGLTFELIAEDAFRFHERGFPSR
YTVGVQGLPESGEYHWRDGGEAHVNDPTSIANIQDAVRTKNDKSYEAYSRSEYEQIKNCTLRGLLDFNFDERTPV
PIDQVEPWTEIVRRFCTGAMSYGSISMESHSTLAVAMNRLGGKSNTGEGGEDPERAQRLPNGDTMRSAIKQVASG
RFGVTSAYLANSDELQIKMAQGAKPGEGGELPGHKVSKSIARTRHSTPGVGLISPPPHHDIYSIEDLKQLIYDLK
CSSPRSRVSVKLVSEVGVGIVASGVAKAKADHILISGHDGGTGASRWTGIKYAGLPWELGLAETHQTLVLNDLRG
RVVVQTDGQLRTGRDIAIACLLGAEEWGFATAPLIALGCIITRKCHLNTCPVGIATQDPELRKKFQGTPEHAINF
FYYLANELRAIMAQLGFRTINEMVGHVEVLKVRDDLRTKKTANIDLSLLLTPAHKLRPGVATFNVRKQDHKLYIR
LDNKLISEAELTLDKGLPSRIECDIINTDRAMGTSLSYQISKRYGEAGLPLDTVHVSIKGSAGQSFGAFLAPGVT
LELEGDANDYVGKGLSGGRLIIYPPRAAVFKAEENILIGNVCLYGATSGTCFFRGVAAERFAVRNSGATAVVEGV
GDHGCEYMTGGRVVILGSTGRNFAAGMSGGIAYILDVHRDFHGKLNTEMVEAGPLEDPAEIAHLRGLIEDHHHYT
GSERAARILVDFTRALPRFVKVLPVDYKRVLEEEAVKAAAAKRAEYNLPVVPGPKHKASVDQVSKLQDMEEAVGD
KAAEKKRALVLDKTRGFMKYARRSEKYRSVNSRVKDWAELSSRLDQDELKYQSARCMDCGVPFCQSETGCPISNI
IPKWNELVFQNQWRDALNRLLMTNNFPEFTGRVCPAPCEGACVLGINEDPVGIKSIECAIIDRGFEMGWMVPQPP
KVRTGKKVAVIGSGPAGLACADQLNRAGHNVTVYERADRLGGLLMYGIPNMKLDKRVVKRRTDFMAAEGVKFETG
VSVGEQGQPNLDELRSGHDAVVIATGATVARDLPIKGRELDGIHFAMEFLHKNTKSLLDSELADEAYISAKDKHV
VVIGGGDTGNDCIGTSVRHGAKSVTNFELLPQPPPERASDNPWPQWPRIYRVDYGHSEVRQHTGRDPREYCIMSE
EFIDDGSGRVKGIKTIRVEWTKSPSGGWDMKKVDGSQQFFPADLVLLAMGFLGPESRVLGDEIEKDGRKNVKTPP
GRYSTNLEGVFAAGDARRGQSLIVWGINEGRMAAREVDLHLEKCTSLPVTGGIVKRTAQEILGRIEAH
Coding >Ophio5|7088
ATGCACAAACAACACTTTCTGCCCTTCCGCTTCCGCAACCACCAAGTCGTCCATTGGCCCATCAACGGCCCTAGC
TGGAGCACGATCGTGGCATCGTGGCCGCACCGAAAAGAAGCTTTGGCATGTGCTCAGCTCACGCAAACCGAGGGC
TGGAGTCCCGAAGCCATCCGTTCCAGAGCAGCCTTCGGCGCTGCTCTCACCTATAACTTTTTTTCCAATTTCGCT
GCCAGCCCTCTCCCACTCCTCCGCGACCGTCGCCCGCAATCGCCCGCCGCCGCTCGCCTCCTTCCGGTGCCTGTC
AGCCGCGAATCCTCGCCTAGCATGGGCCTGCTCGAGGATTTCGACGACCGACAAATCTCCATCGAAGCTGAGAAG
CATGCCTACCAGCCCTATGAGTACCAGACAGAGAACAACGCCTCTTGGGCGGGAGCCCTACCGGTGAAGCAGGGA
CTCTATGACCCGTCGTACGAAAAGGACGCCTGCGGAGTCGGCTTCGCCTGCCATATCAAGGGCAAGGCCAGTCAC
AAAATCGTCAGCGATGCGCGCAATCTCCTGTGCAACATGACCCATCGGGGAGCTGTCGGCTCCGACGCTCGTGAT
GGTGACGGCGCAGGCGTCATGACCTCGATCCCTCATTGGTTCTTCATTAAGAACTTTGAGAGGGAGCAGGACGTC
AAGCTTCCCCCCCCCGGCCAGTACGCCGTCGGGAACCTGTTCTTCAAGCCTGATGAAGAGACGTTTGCCGAGTCC
AAGAGGCAGCTGGAAGACGTTGCCGAGTCGCTGGGCTTGCGCGTCCTGGGCTGGCGCCGCCCCCCGGTCGACTCG
ACCCTGCTCGGCCCGGCCGCCAAGTCCCGCGAGCCCTTCATCGCCCAGCCCTTCGTCGTCCTCGCCGACGCCTAC
GGCCCCGGCGACGCCCCCCGACTGACCGACCCGGACGACTTTGACGAGCGTCTCTTCGAGCGCCAACTCTACGTC
CTGCGGAAACGCGCCACTCACACCATCGGCCTCAAGAACTGGTTCTACCTCTGCTCGCTCTCCAACAAGAATATC
GTCTACAAGGGACAGCTTGCCCCCGTGCAGTCCACTCCCGATTCTCGACCAACACTTTTCCCTCGTGGGACCGCG
CCCAGCCGTTGCAACTGGATGCGTGCACGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGACGAGCTGGAGATG
ATGTACCCTATTGTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTGACCATCAAC
GGCGTCCTGTCCCTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCACATGGATCCT
CACAAGGCCGCCTTTTACGAATGGGCCGCGTGCCAGATGGAGCCATGGGACGGCCCGGCTCTCTTCACCTTTGCC
GACGGCCGCTACTGCGGCGCCAATCTGGATCGGAACGGGCTGCGGCCCTGCCGCTTTTACATCATGGACGACGAC
CGCATCATCTGCGCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGACACCGCCGGCCGCATCATCGATGACAAG
GAGCTGAAGGAGGCCGTGGCGAGCCGCCACGACTTCCGCGCCTGGCTTGACCGGGAGCTCATCGTCATGCCCAGC
ATCCTCGAGGCGCTCAACGAGTCCTCGGTCGACCTCGAGGCTAAGCCCGATGCTGCCCTCCTCCAGGAGGACCCG
CTGCTTCTCGCCTTCGGTTACACGTTCGAGCAGGTCAGCCTGCTGCTGGCCCCGATGGCAGCCGACGAAAAGGAG
GCGCTGGGCTCAATGGGCAACGACGCCCCCCTGGCGTGCTTGACCCAGGCGCCGCGTCTCCTCTACGACTACTTC
CGACAGCTCTTCGCGCAGGTCACAAACCCGCCCATCGACCCGATCCGCGAGTCCATCGTCATGTCCTTGGAATGC
TACGTCGGCCCGCAGGGCAACCTGCTCGAGATGGACCCCTCCCAGTGCGGCCGTCTCATGCTGCCGAGCCCCATC
CTGTCGATTCCCGAGTTCAACGCCATCGTCAACATGTCGTCCATCTATCCTAAGTGGACCGTCAAGACCATCGAC
CTGACCTATCCCAAGTCTCAAGGGGTTCAGGGGTACTTGAACCACCTCGACGAGATCTGCAACGAGGCCACGACG
GCCATCGAGGCGCGAGACCGCATCATTGTCCTGTCCGATCGCCGTACCTCGGCCGACCGCTTGGCCGTCTCGGCC
GTGCTCGCCTCCGCCATGGTCCACCACCACCTCGTCAGCAACAAGTGGCGCTCCATGGTCGCCCTCGTCGTCGAG
ACGGCCGAGGCTCGCGAGGTTCACCACATGTGCGTGTTACTGGGCTACGGCACCGACGCCGTCAACCCCTACCTC
GCCATGGAGTGTATCCTGAAGCTCAACCGGGAGGGCTTGATCAAGCGGAAAATCACCGACGAGGCCCTCATCCGC
AACTACAAACACTCGTGCGACGGCGGCATCCTCAAGGTCATGAGCAAGATGGGCATCTCGACCCTCGCCTCGTAC
AAGGGAGCGCAGATCTTCGAAGCACTCGGTCTGGACGAGGAAGTCGTCGACCGATGCTTCAGGGGCACGGCCTCG
CGCATCCAGGGCCTCACCTTTGAGCTGATAGCCGAGGATGCGTTCCGATTCCACGAGCGCGGCTTCCCCTCGCGC
TACACCGTCGGCGTTCAGGGCCTTCCCGAGTCTGGCGAATACCACTGGCGTGACGGCGGCGAGGCTCACGTCAAC
GATCCCACGTCCATCGCCAACATCCAAGACGCCGTCCGCACCAAGAACGACAAGTCGTACGAGGCCTATTCGCGG
TCTGAATACGAGCAGATCAAGAACTGCACGCTGCGCGGCCTCCTCGACTTCAACTTCGACGAGCGGACGCCCGTG
CCCATCGACCAGGTCGAGCCGTGGACCGAGATCGTGCGGCGCTTCTGCACGGGCGCCATGTCGTACGGCTCCATC
TCGATGGAGTCCCACTCGACGTTGGCCGTGGCCATGAACCGGCTGGGCGGCAAGTCGAACACGGGCGAGGGCGGC
GAGGATCCCGAGCGAGCGCAGCGCTTGCCCAACGGCGACACGATGCGGTCTGCCATCAAGCAGGTTGCCTCGGGC
CGCTTCGGCGTCACGTCGGCCTACCTCGCCAACTCGGATGAGCTGCAGATCAAGATGGCCCAGGGCGCGAAGCCT
GGCGAGGGCGGCGAGCTTCCCGGCCACAAGGTGTCCAAGTCGATCGCGCGAACACGACATTCCACCCCGGGCGTC
GGCCTGATCTCGCCGCCCCCGCATCACGACATCTATTCTATCGAGGATCTGAAGCAGCTCATCTACGACCTCAAG
TGCTCCAGCCCCCGCTCGCGCGTCTCGGTCAAGCTCGTCTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTC
GCCAAGGCCAAAGCCGACCACATCCTCATCTCGGGTCACGATGGCGGCACCGGCGCCTCGCGCTGGACGGGCATC
AAGTACGCCGGCCTGCCCTGGGAACTGGGCCTCGCCGAGACGCATCAGACGCTGGTGCTCAACGACCTGCGCGGC
CGTGTCGTGGTGCAGACGGACGGCCAGCTGAGGACCGGACGGGACATTGCCATCGCCTGCCTCCTCGGAGCCGAG
GAATGGGGCTTTGCGACGGCCCCCCTGATTGCCCTGGGCTGCATCATCACCCGCAAGTGCCACCTCAACACGTGC
CCCGTCGGCATCGCGACGCAGGATCCCGAGCTCCGAAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTC
TTCTACTACCTCGCCAACGAGCTCCGCGCCATCATGGCCCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGC
CACGTCGAGGTCCTCAAGGTGCGGGATGATCTCCGGACTAAGAAGACGGCCAACATCGACCTGTCGCTGCTTCTC
ACCCCGGCCCACAAACTGCGTCCCGGGGTGGCCACCTTCAACGTCCGGAAGCAGGACCACAAGCTCTACATCCGG
CTCGACAACAAGCTCATCTCGGAGGCGGAGCTGACACTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATC
ATCAATACGGACCGGGCCATGGGCACGTCGCTGTCGTACCAGATCTCGAAGCGGTACGGCGAGGCCGGCCTGCCA
CTGGACACGGTTCACGTCAGCATCAAGGGGTCGGCCGGCCAGTCGTTTGGTGCCTTCCTGGCCCCCGGCGTCACG
CTGGAGCTTGAGGGAGACGCCAACGACTACGTCGGTAAGGGTCTGTCGGGCGGACGCCTGATCATCTATCCGCCC
CGGGCGGCCGTTTTCAAGGCCGAGGAGAACATACTGATTGGCAACGTGTGCCTGTACGGCGCCACGAGCGGGACG
TGCTTCTTCCGCGGCGTAGCAGCCGAGCGCTTCGCCGTCCGCAACTCAGGCGCCACGGCCGTCGTCGAGGGTGTC
GGTGATCACGGCTGCGAGTACATGACGGGCGGTCGCGTCGTCATTCTCGGCAGCACCGGTCGGAACTTCGCGGCC
GGCATGTCGGGAGGCATCGCCTACATCCTCGACGTCCACCGCGATTTTCACGGGAAGCTGAACACGGAGATGGTC
GAGGCCGGACCGCTCGAGGATCCGGCCGAGATCGCCCACCTGCGCGGGCTCATCGAGGACCATCACCACTACACC
GGATCGGAGCGGGCGGCCCGCATCCTGGTCGACTTCACTCGCGCCCTTCCCCGCTTCGTCAAGGTGCTTCCGGTC
GACTACAAGCGCGTGCTGGAGGAGGAGGCCGTCAAAGCGGCAGCGGCCAAGCGGGCTGAGTACAACCTGCCGGTC
GTGCCCGGCCCCAAGCACAAGGCCTCGGTGGACCAGGTCTCCAAGCTGCAGGACATGGAAGAGGCCGTCGGCGAC
AAGGCGGCGGAGAAGAAGCGAGCGCTGGTGCTGGACAAGACGAGGGGCTTCATGAAGTACGCGCGCCGATCCGAA
AAGTATCGATCCGTCAACTCGCGCGTCAAGGACTGGGCCGAGCTCAGCTCGCGGCTGGACCAGGACGAGCTCAAG
TACCAATCGGCCCGGTGCATGGACTGCGGCGTGCCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATC
ATCCCCAAGTGGAACGAGCTGGTGTTCCAGAACCAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAAC
TTCCCTGAGTTTACGGGTCGGGTGTGTCCGGCGCCGTGCGAGGGCGCCTGCGTGCTGGGCATCAACGAGGATCCG
GTGGGCATCAAGTCCATCGAGTGCGCCATCATCGATCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCC
AAGGTGCGGACGGGCAAAAAGGTGGCCGTCATCGGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAAC
CGGGCGGGCCACAACGTGACGGTGTACGAGCGGGCCGACCGGCTGGGCGGGCTGCTCATGTACGGCATCCCCAAC
ATGAAGCTGGACAAGCGCGTGGTCAAGCGGCGGACCGACTTCATGGCGGCCGAGGGCGTCAAGTTCGAGACGGGT
GTTTCGGTCGGCGAGCAAGGCCAGCCGAATCTGGATGAGCTGCGGAGCGGTCACGACGCTGTCGTCATCGCCACG
GGCGCGACGGTGGCGCGCGACCTTCCCATCAAGGGCCGGGAGCTGGATGGCATCCACTTCGCCATGGAGTTTTTG
CACAAGAATACCAAGTCGCTACTCGATTCGGAGCTGGCCGACGAGGCCTACATCTCAGCCAAGGACAAGCACGTC
GTCGTCATAGGCGGCGGAGACACGGGCAACGACTGCATCGGCACCTCGGTGAGGCACGGGGCCAAGTCGGTGACC
AACTTTGAGCTTCTGCCGCAGCCGCCGCCGGAGCGAGCGAGCGACAACCCGTGGCCGCAGTGGCCTCGCATCTAC
CGTGTCGACTACGGCCACAGCGAGGTTCGTCAGCACACGGGCAGGGACCCGCGCGAGTACTGCATCATGTCGGAG
GAGTTTATCGACGACGGCAGCGGGCGGGTCAAGGGCATCAAGACGATCCGCGTCGAGTGGACCAAGTCGCCGAGC
GGCGGATGGGACATGAAGAAGGTGGACGGATCGCAACAGTTCTTCCCGGCCGACCTGGTGCTGTTGGCCATGGGC
TTCCTGGGGCCCGAGTCACGCGTGCTGGGCGACGAGATTGAGAAGGACGGGCGCAAGAACGTCAAGACGCCGCCG
GGCAGATACAGCACCAACCTGGAGGGGGTGTTTGCGGCGGGCGACGCGCGGCGCGGACAGTCGCTGATTGTGTGG
GGAATCAACGAAGGCCGGATGGCGGCGCGCGAGGTCGATTTGCACCTGGAGAAGTGCACCAGCCTGCCGGTGACG
GGCGGCATAGTGAAGCGCACGGCACAGGAGATTTTGGGCAGAATCGAGGCCCAT
Transcript >Ophio5|7088
ATGCACAAACAACACTTTCTGCCCTTCCGCTTCCGCAACCACCAAGTCGTCCATTGGCCCATCAACGGCCCTAGC
TGGAGCACGATCGTGGCATCGTGGCCGCACCGAAAAGAAGCTTTGGCATGTGCTCAGCTCACGCAAACCGAGGGC
TGGAGTCCCGAAGCCATCCGTTCCAGAGCAGCCTTCGGCGCTGCTCTCACCTATAACTTTTTTTCCAATTTCGCT
GCCAGCCCTCTCCCACTCCTCCGCGACCGTCGCCCGCAATCGCCCGCCGCCGCTCGCCTCCTTCCGGTGCCTGTC
AGCCGCGAATCCTCGCCTAGCATGGGCCTGCTCGAGGATTTCGACGACCGACAAATCTCCATCGAAGCTGAGAAG
CATGCCTACCAGCCCTATGAGTACCAGACAGAGAACAACGCCTCTTGGGCGGGAGCCCTACCGGTGAAGCAGGGA
CTCTATGACCCGTCGTACGAAAAGGACGCCTGCGGAGTCGGCTTCGCCTGCCATATCAAGGGCAAGGCCAGTCAC
AAAATCGTCAGCGATGCGCGCAATCTCCTGTGCAACATGACCCATCGGGGAGCTGTCGGCTCCGACGCTCGTGAT
GGTGACGGCGCAGGCGTCATGACCTCGATCCCTCATTGGTTCTTCATTAAGAACTTTGAGAGGGAGCAGGACGTC
AAGCTTCCCCCCCCCGGCCAGTACGCCGTCGGGAACCTGTTCTTCAAGCCTGATGAAGAGACGTTTGCCGAGTCC
AAGAGGCAGCTGGAAGACGTTGCCGAGTCGCTGGGCTTGCGCGTCCTGGGCTGGCGCCGCCCCCCGGTCGACTCG
ACCCTGCTCGGCCCGGCCGCCAAGTCCCGCGAGCCCTTCATCGCCCAGCCCTTCGTCGTCCTCGCCGACGCCTAC
GGCCCCGGCGACGCCCCCCGACTGACCGACCCGGACGACTTTGACGAGCGTCTCTTCGAGCGCCAACTCTACGTC
CTGCGGAAACGCGCCACTCACACCATCGGCCTCAAGAACTGGTTCTACCTCTGCTCGCTCTCCAACAAGAATATC
GTCTACAAGGGACAGCTTGCCCCCGTGCAGTCCACTCCCGATTCTCGACCAACACTTTTCCCTCGTGGGACCGCG
CCCAGCCGTTGCAACTGGATGCGTGCACGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGACGAGCTGGAGATG
ATGTACCCTATTGTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTGACCATCAAC
GGCGTCCTGTCCCTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCACATGGATCCT
CACAAGGCCGCCTTTTACGAATGGGCCGCGTGCCAGATGGAGCCATGGGACGGCCCGGCTCTCTTCACCTTTGCC
GACGGCCGCTACTGCGGCGCCAATCTGGATCGGAACGGGCTGCGGCCCTGCCGCTTTTACATCATGGACGACGAC
CGCATCATCTGCGCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGACACCGCCGGCCGCATCATCGATGACAAG
GAGCTGAAGGAGGCCGTGGCGAGCCGCCACGACTTCCGCGCCTGGCTTGACCGGGAGCTCATCGTCATGCCCAGC
ATCCTCGAGGCGCTCAACGAGTCCTCGGTCGACCTCGAGGCTAAGCCCGATGCTGCCCTCCTCCAGGAGGACCCG
CTGCTTCTCGCCTTCGGTTACACGTTCGAGCAGGTCAGCCTGCTGCTGGCCCCGATGGCAGCCGACGAAAAGGAG
GCGCTGGGCTCAATGGGCAACGACGCCCCCCTGGCGTGCTTGACCCAGGCGCCGCGTCTCCTCTACGACTACTTC
CGACAGCTCTTCGCGCAGGTCACAAACCCGCCCATCGACCCGATCCGCGAGTCCATCGTCATGTCCTTGGAATGC
TACGTCGGCCCGCAGGGCAACCTGCTCGAGATGGACCCCTCCCAGTGCGGCCGTCTCATGCTGCCGAGCCCCATC
CTGTCGATTCCCGAGTTCAACGCCATCGTCAACATGTCGTCCATCTATCCTAAGTGGACCGTCAAGACCATCGAC
CTGACCTATCCCAAGTCTCAAGGGGTTCAGGGGTACTTGAACCACCTCGACGAGATCTGCAACGAGGCCACGACG
GCCATCGAGGCGCGAGACCGCATCATTGTCCTGTCCGATCGCCGTACCTCGGCCGACCGCTTGGCCGTCTCGGCC
GTGCTCGCCTCCGCCATGGTCCACCACCACCTCGTCAGCAACAAGTGGCGCTCCATGGTCGCCCTCGTCGTCGAG
ACGGCCGAGGCTCGCGAGGTTCACCACATGTGCGTGTTACTGGGCTACGGCACCGACGCCGTCAACCCCTACCTC
GCCATGGAGTGTATCCTGAAGCTCAACCGGGAGGGCTTGATCAAGCGGAAAATCACCGACGAGGCCCTCATCCGC
AACTACAAACACTCGTGCGACGGCGGCATCCTCAAGGTCATGAGCAAGATGGGCATCTCGACCCTCGCCTCGTAC
AAGGGAGCGCAGATCTTCGAAGCACTCGGTCTGGACGAGGAAGTCGTCGACCGATGCTTCAGGGGCACGGCCTCG
CGCATCCAGGGCCTCACCTTTGAGCTGATAGCCGAGGATGCGTTCCGATTCCACGAGCGCGGCTTCCCCTCGCGC
TACACCGTCGGCGTTCAGGGCCTTCCCGAGTCTGGCGAATACCACTGGCGTGACGGCGGCGAGGCTCACGTCAAC
GATCCCACGTCCATCGCCAACATCCAAGACGCCGTCCGCACCAAGAACGACAAGTCGTACGAGGCCTATTCGCGG
TCTGAATACGAGCAGATCAAGAACTGCACGCTGCGCGGCCTCCTCGACTTCAACTTCGACGAGCGGACGCCCGTG
CCCATCGACCAGGTCGAGCCGTGGACCGAGATCGTGCGGCGCTTCTGCACGGGCGCCATGTCGTACGGCTCCATC
TCGATGGAGTCCCACTCGACGTTGGCCGTGGCCATGAACCGGCTGGGCGGCAAGTCGAACACGGGCGAGGGCGGC
GAGGATCCCGAGCGAGCGCAGCGCTTGCCCAACGGCGACACGATGCGGTCTGCCATCAAGCAGGTTGCCTCGGGC
CGCTTCGGCGTCACGTCGGCCTACCTCGCCAACTCGGATGAGCTGCAGATCAAGATGGCCCAGGGCGCGAAGCCT
GGCGAGGGCGGCGAGCTTCCCGGCCACAAGGTGTCCAAGTCGATCGCGCGAACACGACATTCCACCCCGGGCGTC
GGCCTGATCTCGCCGCCCCCGCATCACGACATCTATTCTATCGAGGATCTGAAGCAGCTCATCTACGACCTCAAG
TGCTCCAGCCCCCGCTCGCGCGTCTCGGTCAAGCTCGTCTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTC
GCCAAGGCCAAAGCCGACCACATCCTCATCTCGGGTCACGATGGCGGCACCGGCGCCTCGCGCTGGACGGGCATC
AAGTACGCCGGCCTGCCCTGGGAACTGGGCCTCGCCGAGACGCATCAGACGCTGGTGCTCAACGACCTGCGCGGC
CGTGTCGTGGTGCAGACGGACGGCCAGCTGAGGACCGGACGGGACATTGCCATCGCCTGCCTCCTCGGAGCCGAG
GAATGGGGCTTTGCGACGGCCCCCCTGATTGCCCTGGGCTGCATCATCACCCGCAAGTGCCACCTCAACACGTGC
CCCGTCGGCATCGCGACGCAGGATCCCGAGCTCCGAAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTC
TTCTACTACCTCGCCAACGAGCTCCGCGCCATCATGGCCCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGC
CACGTCGAGGTCCTCAAGGTGCGGGATGATCTCCGGACTAAGAAGACGGCCAACATCGACCTGTCGCTGCTTCTC
ACCCCGGCCCACAAACTGCGTCCCGGGGTGGCCACCTTCAACGTCCGGAAGCAGGACCACAAGCTCTACATCCGG
CTCGACAACAAGCTCATCTCGGAGGCGGAGCTGACACTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATC
ATCAATACGGACCGGGCCATGGGCACGTCGCTGTCGTACCAGATCTCGAAGCGGTACGGCGAGGCCGGCCTGCCA
CTGGACACGGTTCACGTCAGCATCAAGGGGTCGGCCGGCCAGTCGTTTGGTGCCTTCCTGGCCCCCGGCGTCACG
CTGGAGCTTGAGGGAGACGCCAACGACTACGTCGGTAAGGGTCTGTCGGGCGGACGCCTGATCATCTATCCGCCC
CGGGCGGCCGTTTTCAAGGCCGAGGAGAACATACTGATTGGCAACGTGTGCCTGTACGGCGCCACGAGCGGGACG
TGCTTCTTCCGCGGCGTAGCAGCCGAGCGCTTCGCCGTCCGCAACTCAGGCGCCACGGCCGTCGTCGAGGGTGTC
GGTGATCACGGCTGCGAGTACATGACGGGCGGTCGCGTCGTCATTCTCGGCAGCACCGGTCGGAACTTCGCGGCC
GGCATGTCGGGAGGCATCGCCTACATCCTCGACGTCCACCGCGATTTTCACGGGAAGCTGAACACGGAGATGGTC
GAGGCCGGACCGCTCGAGGATCCGGCCGAGATCGCCCACCTGCGCGGGCTCATCGAGGACCATCACCACTACACC
GGATCGGAGCGGGCGGCCCGCATCCTGGTCGACTTCACTCGCGCCCTTCCCCGCTTCGTCAAGGTGCTTCCGGTC
GACTACAAGCGCGTGCTGGAGGAGGAGGCCGTCAAAGCGGCAGCGGCCAAGCGGGCTGAGTACAACCTGCCGGTC
GTGCCCGGCCCCAAGCACAAGGCCTCGGTGGACCAGGTCTCCAAGCTGCAGGACATGGAAGAGGCCGTCGGCGAC
AAGGCGGCGGAGAAGAAGCGAGCGCTGGTGCTGGACAAGACGAGGGGCTTCATGAAGTACGCGCGCCGATCCGAA
AAGTATCGATCCGTCAACTCGCGCGTCAAGGACTGGGCCGAGCTCAGCTCGCGGCTGGACCAGGACGAGCTCAAG
TACCAATCGGCCCGGTGCATGGACTGCGGCGTGCCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATC
ATCCCCAAGTGGAACGAGCTGGTGTTCCAGAACCAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAAC
TTCCCTGAGTTTACGGGTCGGGTGTGTCCGGCGCCGTGCGAGGGCGCCTGCGTGCTGGGCATCAACGAGGATCCG
GTGGGCATCAAGTCCATCGAGTGCGCCATCATCGATCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCC
AAGGTGCGGACGGGCAAAAAGGTGGCCGTCATCGGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAAC
CGGGCGGGCCACAACGTGACGGTGTACGAGCGGGCCGACCGGCTGGGCGGGCTGCTCATGTACGGCATCCCCAAC
ATGAAGCTGGACAAGCGCGTGGTCAAGCGGCGGACCGACTTCATGGCGGCCGAGGGCGTCAAGTTCGAGACGGGT
GTTTCGGTCGGCGAGCAAGGCCAGCCGAATCTGGATGAGCTGCGGAGCGGTCACGACGCTGTCGTCATCGCCACG
GGCGCGACGGTGGCGCGCGACCTTCCCATCAAGGGCCGGGAGCTGGATGGCATCCACTTCGCCATGGAGTTTTTG
CACAAGAATACCAAGTCGCTACTCGATTCGGAGCTGGCCGACGAGGCCTACATCTCAGCCAAGGACAAGCACGTC
GTCGTCATAGGCGGCGGAGACACGGGCAACGACTGCATCGGCACCTCGGTGAGGCACGGGGCCAAGTCGGTGACC
AACTTTGAGCTTCTGCCGCAGCCGCCGCCGGAGCGAGCGAGCGACAACCCGTGGCCGCAGTGGCCTCGCATCTAC
CGTGTCGACTACGGCCACAGCGAGGTTCGTCAGCACACGGGCAGGGACCCGCGCGAGTACTGCATCATGTCGGAG
GAGTTTATCGACGACGGCAGCGGGCGGGTCAAGGGCATCAAGACGATCCGCGTCGAGTGGACCAAGTCGCCGAGC
GGCGGATGGGACATGAAGAAGGTGGACGGATCGCAACAGTTCTTCCCGGCCGACCTGGTGCTGTTGGCCATGGGC
TTCCTGGGGCCCGAGTCACGCGTGCTGGGCGACGAGATTGAGAAGGACGGGCGCAAGAACGTCAAGACGCCGCCG
GGCAGATACAGCACCAACCTGGAGGGGGTGTTTGCGGCGGGCGACGCGCGGCGCGGACAGTCGCTGATTGTGTGG
GGAATCAACGAAGGCCGGATGGCGGCGCGCGAGGTCGATTTGCACCTGGAGAAGTGCACCAGCCTGCCGGTGACG
GGCGGCATAGTGAAGCGCACGGCACAGGAGATTTTGGGCAGAATCGAGGCCCATTAG
Gene >Ophio5|7088
ATGCACAAACAACACTTTCTGCCCTTCCGCTTCCGCAACCACCAAGTCGTCCATTGGCCCATCAACGGCCCTAGC
TGGAGCACGATCGTGGCATCGTGGCCGCACCGAAAAGAAGCTTTGGCATGTGCTCAGCTCACGCAAACCGAGGGC
TGGAGTCCCGAAGCCGTGTCTTAGCCATGGCAGGCGGTCAGGCTCCCGACCATTGGCTGCACCAAGTCTCCTGCA
GCAAGTCTCGTGGCGCCCCGGCTGCCAGATGCGAGCAGGGAACCGAGCCTATTTGATGCGATGCAAGGCTCTGCC
TCATCTTTCCGCGAGCATTTCTTCCCACCAAGCCGTCCGCAAGCGAAAAGAAAAAAAAAGCCAAAAAATAGGTCC
CTCGCGAGAGCGCCCAAAAAAAAAAAAAGAGGGGACGTGCCGATGCCGGCCAGTGGGAGTGGCGCAGATACAAAG
CACACATCCGTAGTCGCGGGGGAGGTCCCGGCATCGGATCGCTAGGCGAACAATGCCATCAGCCGCATCTCCAAG
CGTCTAAGCAGATTGCCGACCGGTATTCACGACTCGACGAGACACGCACGAGTCAAGAATAAAGGGAAAATCGAA
AAAGAAAAAAAGGGTCTGCCAAGAGTGGGATAGTGCGTTCGACAACCGGAGCATCCATCCGTTCACGTCGCCCAA
CTGTCGGACCCAACTCCTAACCTTACCCGCAGGGGCCCCCCTTCCGCCAGGCTTTTCTGTTCCTTCTCCATCTCG
TCGCCCTCTCCACATCGCCACTCTCACCTCTCATCCGCAGACCTGACTGACAACGCCTCCGTCACAGATAGATCC
GTTCCAGAGCAGCCTTCGGCGCTGCTCTCACCTATAACTTTTTTTCCAATTTCGCTGCCAGCCCTCTCCCACTCC
TCCGCGACCGTCGCCCGCAATCGCCCGCCGCCGCTCGCCTCCTTCCGGTGCCTGTCAGCCGCGAATCCTCGCCTA
GCATGGGCCTGCTCGAGGATTTCGACGACCGACAAATCTCCATCGAAGCTGAGAAGCATGCCTACCAGCCCTATG
AGTACCAGACAGAGAACAACGCCTCTTGGGCGGGAGCCCTACCGGTGAAGCAGGGACTCTATGACCCGTCGTACG
AAAAGGACGCCTGCGGAGTCGGCTTCGCCTGGTGAGTTTCGCGCGCCATCGAAAAGATCGCTTCCGCTGACCCGC
GCTTGCAGCCATATCAAGGGCAAGGCCAGTCACAAAATCGTCAGCGATGCGCGCAATCTCCTGTGCAACATGACC
CATCGGGGAGCTGTCGGCTCCGACGCTCGTGATGGTGACGGCGCAGGCGTCATGACCTCGATCCCTCATTGGTTC
TTCATTAAGAACTTTGAGAGGGAGCAGGACGTCAAGCTTCCCCCCCCCGGCCAGTACGCCGTCGGGAACCTGTTC
TTCAAGCCTGATGAAGAGACGTTTGCCGAGTCCAAGAGGCAGCTGGAAGACGTTGCCGAGTCGCTGGGCTTGCGC
GTCCTGGGCTGGCGCCGCCCCCCGGTCGACTCGACCCTGCTCGGCCCGGCCGCCAAGTCCCGCGAGCCCTTCATC
GCCCAGCCCTTCGTCGTCCTCGCCGACGCCTACGGCCCCGGCGACGCCCCCCGACTGACCGACCCGGACGACTTT
GACGAGCGTCTCTTCGAGCGCCAACTCTACGTCCTGCGGAAACGCGCCACTCACACCATCGGCCTCAAGAACTGG
TTCTACCTCTGCTCGCTCTCCAACAAGAATATCGTCTACAAGGGACAGCTTGCCCCCGTGCAGGTCTATTCATAC
TACCACGACCTGGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCCCGATTCTCGACCAACACTTTT
CCCTCGTGGGACCGCGCCCAGCCGTTGCGTTGGGCCGCTCACAATGGCGAGATCAACACGCTGCGTGGCAACAAG
AACTGGATGCGTGCACGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGACGAGCTGGAGATGATGTACCCTATT
GTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTGACCATCAACGGCGTCCTGTCC
CTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCACATGGATCCTCACAAGGCCGCC
TTTTACGAATGGGCCGCGTGCCAGATGGAGCCATGGGACGGCCCGGCTCTCTTCACCTTTGCCGACGGCCGCTAC
TGCGGCGCCAATCTGGATCGGAACGGGCTGCGGCCCTGCCGCTTTTACATCATGGACGACGACCGCATCATCTGC
GCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGACACCGTCACCTACAAGGGCCGCTTGCAGCCTGGACGCATG
CTACTGGTCGACACACAGGCCGGCCGCATCATCGATGACAAGGAGCTGAAGGAGGCCGTGGCGAGCCGCCACGAC
TTCCGCGCCTGGCTTGACCGGGAGCTCATCGTCATGCCCAGCATCCTCGAGGCGCTCAACGAGTCCTCGGTCGAC
CTCGAGGCTAAGCCCGATGCTGCCCTCCTCCAGGAGGACCCGCTGCTTCTCGCCTTCGGTTACACGTTCGAGCAG
GTCAGCCTGCTGCTGGCCCCGATGGCAGCCGACGAAAAGGAGGCGCTGGGCTCAATGGGCAACGACGCCCCCCTG
GCGTGCTTGACCCAGGCGCCGCGTCTCCTCTACGACTACTTCCGACAGCTCTTCGCGCAGGTCACAAACCCGCCC
ATCGACCCGATCCGCGAGTCCATCGTCATGTCCTTGGAATGCTACGTCGGCCCGCAGGGCAACCTGCTCGAGATG
GACCCCTCCCAGTGCGGCCGTCTCATGCTGCCGAGCCCCATCCTGTCGATTCCCGAGTTCAACGCCATCGTCAAC
ATGTCGTCCATCTATCCTAAGTGGACCGTCAAGACCATCGACCTGACCTATCCCAAGTCTCAAGGGGTTCAGGGG
TACTTGAACCACCTCGACGAGATCTGCAACGAGGCCACGACGGCCATCGAGGCGCGAGACCGCATCATTGTCCTG
TCCGATCGCCGTACCTCGGCCGACCGCTTGGCCGTCTCGGCCGTGCTCGCCTCCGCCATGGTCCACCACCACCTC
GTCAGCAACAAGTGGCGCTCCATGGTCGCCCTCGTCGTCGAGACGGCCGAGGCTCGCGAGGTTCACCACATGTGC
GTGTTACTGGGCTACGGCACCGACGCCGTCAACCCCTACCTCGCCATGGAGTGTATCCTGAAGCTCAACCGGGAG
GGCTTGATCAAGCGGAAAATCACCGACGAGGCCCTCATCCGCAACTACAAACACTCGTGCGACGGCGGCATCCTC
AAGGTCATGAGCAAGATGGGCATCTCGACCCTCGCCTCGTACAAGGGAGCGCAGATCTTCGAAGCACTCGGTCTG
GACGAGGAAGTCGTCGACCGATGCTTCAGGGGCACGGCCTCGCGCATCCAGGGCCTCACCTTTGAGCTGATAGCC
GAGGATGCGTTCCGATTCCACGAGCGCGGCTTCCCCTCGCGCTACACCGTCGGCGTTCAGGGCCTTCCCGAGTCT
GGCGAATACCACTGGCGTGACGGCGGCGAGGCTCACGTCAACGATCCCACGTCCATCGCCAACATCCAAGACGCC
GTCCGCACCAAGAACGACAAGTCGTACGAGGCCTATTCGCGGTCTGAATACGAGCAGATCAAGAACTGCACGCTG
CGCGGCCTCCTCGACTTCAACTTCGACGAGCGGACGCCCGTGCCCATCGACCAGGTCGAGCCGTGGACCGAGATC
GTGCGGCGCTTCTGCACGGGCGCCATGTCGTACGGCTCCATCTCGATGGAGTCCCACTCGACGTTGGCCGTGGCC
ATGAACCGGCTGGGCGGCAAGTCGAACACGGGCGAGGGCGGCGAGGATCCCGAGCGAGCGCAGCGCTTGCCCAAC
GGCGACACGATGCGGTCTGCCATCAAGCAGGTTGCCTCGGGCCGCTTCGGCGTCACGTCGGCCTACCTCGCCAAC
TCGGATGAGCTGCAGATCAAGATGGCCCAGGGCGCGAAGCCTGGCGAGGGCGGCGAGCTTCCCGGCCACAAGGTG
TCCAAGTCGATCGCGCGAACACGACATTCCACCCCGGGCGTCGGCCTGATCTCGCCGCCCCCGCATCACGACATC
TATTCTATCGAGGATCTGAAGCAGCTCATCTACGACCTCAAGTGCTCCAGCCCCCGCTCGCGCGTCTCGGTCAAG
CTCGTCTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTCGCCAAGGCCAAAGCCGACCACATCCTCATCTCG
GGTCACGATGGCGGCACCGGCGCCTCGCGCTGGACGGGCATCAAGTACGCCGGCCTGCCCTGGGAACTGGGCCTC
GCCGAGACGCATCAGACGCTGGTGCTCAACGACCTGCGCGGCCGTGTCGTGGTGCAGACGGACGGCCAGCTGAGG
ACCGGACGGGACATTGCCATCGCCTGCCTCCTCGGAGCCGAGGAATGGGGCTTTGCGACGGCCCCCCTGATTGCC
CTGGGCTGCATCATCACCCGCAAGTGCCACCTCAACACGTGCCCCGTCGGCATCGCGACGCAGGATCCCGAGCTC
CGAAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTCTTCTACTACCTCGCCAACGAGCTCCGCGCCATC
ATGGCCCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGCCACGTCGAGGTCCTCAAGGTGCGGGATGATCTC
CGGACTAAGAAGACGGCCAACATCGACCTGTCGCTGCTTCTCACCCCGGCCCACAAACTGCGTCCCGGGGTGGCC
ACCTTCAACGTCCGGAAGCAGGACCACAAGCTCTACATCCGGCTCGACAACAAGCTCATCTCGGAGGCGGAGCTG
ACACTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATCATCAATACGGACCGGGCCATGGGCACGTCGCTG
TCGTACCAGATCTCGAAGCGGTACGGCGAGGCCGGCCTGCCACTGGACACGGTTCACGTCAGCATCAAGGGGTCG
GCCGGCCAGTCGTTTGGTGCCTTCCTGGCCCCCGGCGTCACGCTGGAGCTTGAGGGAGACGCCAACGACTACGTC
GGTAAGGGTCTGTCGGGCGGACGCCTGATCATCTATCCGCCCCGGGCGGCCGTTTTCAAGGCCGAGGAGAACATA
CTGATTGGCAACGTGTGCCTGTACGGCGCCACGAGCGGGACGTGCTTCTTCCGCGGCGTAGCAGCCGAGCGCTTC
GCCGTCCGCAACTCAGGCGCCACGGCCGTCGTCGAGGGTGTCGGTGATCACGGCTGCGAGTACATGACGGGCGGT
CGCGTCGTCATTCTCGGCAGCACCGGTCGGAACTTCGCGGCCGGCATGTCGGGAGGCATCGCCTACATCCTCGAC
GTCCACCGCGATTTTCACGGGAAGCTGAACACGGAGATGGTCGAGGCCGGACCGCTCGAGGATCCGGCCGAGATC
GCCCACCTGCGCGGGCTCATCGAGGACCATCACCACTACACCGGATCGGAGCGGGCGGCCCGCATCCTGGTCGAC
TTCACTCGCGCCCTTCCCCGCTTCGTCAAGGTGCTTCCGGTCGACTACAAGCGCGTGCTGGAGGAGGAGGCCGTC
AAAGCGGCAGCGGCCAAGCGGGCTGAGTACAACCTGCCGGTCGTGCCCGGCCCCAAGCACAAGGCCTCGGTGGAC
CAGGTCTCCAAGCTGCAGGACATGGAAGAGGCCGTCGGCGACAAGGCGGCGGAGAAGAAGCGAGCGCTGGTGCTG
GACAAGACGAGGGGCTTCATGAAGTACGCGCGCCGATCCGAAAAGTATCGATCCGTCAACTCGCGCGTCAAGGAC
TGGGCCGAGCTCAGCTCGCGGCTGGACCAGGACGAGCTCAAGTACCAATCGGCCCGGTGCATGGACTGCGGCGTG
CCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATCATCCCCAAGTGGAACGAGCTGGTGTTCCAGAAC
CAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAACTTCCCTGAGTTTACGGGTCGGGTGTGTCCGGCG
CCGTGCGAGGGCGCCTGCGTGCTGGGCATCAACGAGGATCCGGTGGGCATCAAGTCCATCGAGTGCGCCATCATC
GATCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCCAAGGTGCGGACGGGCAAAAAGGTGGCCGTCATC
GGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAACCGGGCGGGCCACAACGTGACGGTGTACGAGCGG
GCCGACCGGCTGGGCGGGCTGCTCATGTACGGCATCCCCAACATGAAGCTGGACAAGCGCGTGGTCAAGCGGCGG
ACCGACTTCATGGCGGCCGAGGGCGTCAAGTTCGAGACGGGTGTTTCGGTCGGCGAGCAAGGCCAGCCGAATCTG
GATGAGCTGCGGAGCGGTCACGACGCTGTCGTCATCGCCACGGGCGCGACGGTGGCGCGCGACCTTCCCATCAAG
GGCCGGGAGCTGGATGGCATCCACTTCGCCATGGAGTTTTTGCACAAGAATACCAAGTCGCTACTCGATTCGGAG
CTGGCCGACGAGGCCTACATCTCAGCCAAGGACAAGCACGTCGTCGTCATAGGCGGCGGAGACACGGGCAACGAC
TGCATCGGCACCTCGGTGAGGCACGGGGCCAAGTCGGTGACCAACTTTGAGCTTCTGCCGCAGCCGCCGCCGGAG
CGAGCGAGCGACAACCCGTGGCCGCAGTGGCCTCGCATCTACCGTGTCGACTACGGCCACAGCGAGGTTCGTCAG
CACACGGGCAGGGACCCGCGCGAGTACTGCATCATGTCGGAGGAGTTTATCGACGACGGCAGCGGGCGGGTCAAG
GGCATCAAGACGATCCGCGTCGAGTGGACCAAGTCGCCGAGCGGCGGATGGGACATGAAGAAGGTGGACGGATCG
CAACAGTTCTTCCCGGCCGACCTGGTGCTGTTGGCCATGGGCTTCCTGGGGCCCGAGTCACGCGTGCTGGGCGAC
GAGATTGAGAAGGACGGGCGCAAGAACGTCAAGACGCCGCCGGGCAGATACAGCACCAACCTGGAGGGGGTGTTT
GCGGCGGGCGACGCGCGGCGCGGACAGTCGCTGATTGTGTGGTACGTGGACGATTGCTCCTCGTCTTGGGGACCC
GTTGTTTGCTGACGGTTGCATCCAGGGGAATCAACGAAGGCCGGATGGCGGCGCGCGAGGTCGATTTGCACCTGG
AGAAGTGCACCAGCCTGCCGGTGACGGGCGGCATAGTGAAGCGCACGGCACAGGAGATTTTGGGCAGAATCGAGG
CCCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail