Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7084
Gene name
Locationscaffold_66:1497..5140
Strand-
Gene length (bp)3643
Transcript length (bp)3576
Coding sequence length (bp)3573
Protein length (aa) 1191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04097 Nic96 Nup93/Nic96 2.0E-210 524 1183
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 3.1E-08 2 88
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 3.2E-06 77 148
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 2.8E-04 144 223
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.6E+00 188 246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 143 1191 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 569 1185 4.0E-90
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 567 1191 4.0E-81
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 270 1185 3.0E-60
sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup93 OS=Pongo abelii GN=NUP93 PE=2 SV=2 555 1176 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 143 1191 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 569 1185 4.0E-90
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 567 1191 4.0E-81
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 270 1185 3.0E-60
sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup93 OS=Pongo abelii GN=NUP93 PE=2 SV=2 555 1176 5.0E-33
sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 555 1176 7.0E-33
sp|Q8BJ71|NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus GN=Nup93 PE=1 SV=1 555 1176 1.0E-32
sp|A5PJZ5|NUP93_BOVIN Nuclear pore complex protein Nup93 OS=Bos taurus GN=NUP93 PE=2 SV=1 555 1176 1.0E-32
sp|Q66HC5|NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus GN=Nup93 PE=1 SV=1 555 1176 2.0E-32
sp|Q7ZU29|NUP93_DANRE Nuclear pore complex protein Nup93 OS=Danio rerio GN=dye PE=2 SV=1 555 1177 3.0E-32
sp|Q6NX12|NUP93_XENTR Nuclear pore complex protein Nup93 OS=Xenopus tropicalis GN=nup93 PE=2 SV=1 555 1140 6.0E-31
sp|Q7ZX96|NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis GN=nup93 PE=2 SV=1 555 1140 2.0E-28
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 2 231 3.0E-18
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 22 224 7.0E-15
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 2 217 5.0E-14
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 3 178 1.0E-13
sp|O22224|NP93A_ARATH Nuclear pore complex protein NUP93A OS=Arabidopsis thaliana GN=NUP93A PE=1 SV=2 270 1132 3.0E-13
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 6 214 5.0E-13
sp|F4J284|NU93B_ARATH Nuclear pore complex protein NUP93B OS=Arabidopsis thaliana GN=NUP93B PE=1 SV=1 270 1132 9.0E-13
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 21 249 1.0E-10
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 13 171 2.0E-10
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 3 234 2.0E-10
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 2 263 3.0E-10
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 2 226 6.0E-10
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 91 250 1.0E-08
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 73 239 7.0E-08
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 2 185 1.0E-07
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 2 169 3.0E-07
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 2 227 3.0E-07
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 9 172 4.0E-07
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 3 156 5.0E-07
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 78 166 7.0E-07
sp|G0S381|AMO1_CHATD Nucleoporin AMO1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=AMO1 PE=3 SV=1 1 214 7.0E-07
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 2 153 8.0E-07
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 10 169 8.0E-07
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 270 424 8.0E-07
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 2 217 9.0E-07
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 3 206 1.0E-06
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 7 127 2.0E-06
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 3 156 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0140513 nuclear protein-containing complex No
GO:0005198 structural molecule activity No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7084
MSVFGQQPASGSSVFGQQPQQQQPSSGGGLFGQQTQNQTSGSGPFGQPAQTQTTGGGLFGQPARNQSTTTTTTTM
GGGGGLFGQTTATGGSSPFGQPAQAQATATGGGGLFGQPAQNQTTGGGGLFGQPAQNQTTGGGLFGQPASTSTTG
LFGQPSQNQTSGGGVFGQQAQNQQQKPPSSFGGSTLQGSVFGAPTAKPSLSLFGSTTADANAQPQQNASLSFGSL
ALGGGLAAAPAQAQQQQQQLAGAYFDSLFAKTLKEGGGKTNMESLPSLELGLGDLRHRLRKLQHKSNEKPLDGKA
HYLLAASGVDPSIAAKDLGLLDVQGARVDRANGYAPSELDVETYLSNLQTKTTLSMISDDLERSLRDFDNFLEDH
VAMEWDAQRKRIYQHFGIKPRQDSAAARDPQAASFGRSRRSKSHGGGSRAGGRSTVLGMSSAQRSVIGPPSRIGA
HPSDFSDVKGSPDASGAALKTRTATELRVLRDRQAKLADKVRALNAARLDKRPYAILAELCDVVHKSPEAHAPHV
VEAYLAMMELVGEDESLMGERRFAELYLDDNAQSAAAVDMRKRILHGANRFLEQQFMRHVDSLIAKHPHDAKLGG
RPDVTSKIRAYIRLRSAHKDLVPDNTELQQMQGEYVWAVVFYLLRSGHVKEAAQFVNDKSGQFRGIDRTFGTYLN
NYASSEDRRITNRKLLDRCTNEYAQRARNAPDHSIDPFRMACYKVIGRIELGNRNLDGLHTDINDWIWLQFNLAR
EGDRSVEMAGESYGLAELQASVRDIGLKHFPKASAADDANNGSFGMFFYLQILAGMFEDAVAYLYPFSYVDAVHF
ALALTYHGLLRPSDPTSGSNELRSLSVKDVPQINFGRMLGYYTRDFRAADVVSAVDYLALICLNRDLAGEAGRRQ
GALCHEALRDLVLETREFSKLLGDIRPDGRGIRGVIEERAPLMGLDDDDGHFVATVTLQAASFADETGRTTDAVL
LYHLAGEYDTVVAIVSRALSEAVSLEMGEDPMRLAPVKPREADAQQGSSLSLAAIDDPVELAKVMMAMYERDAMF
YGKIQAENRVACHVLLEMSGIKKLVEAGRWAQALDKIRGLEILPLDAAGDASTIRAYASKFSALSQPVSINVPNL
LMWTIICCLRQREQLTNGQFSGNEGTRRLMVDQLKQMTLDLTTYTSQLRYRFPPHLHEALARASAE
Coding >Ophio5|7084
ATGTCGGTCTTCGGGCAGCAGCCGGCCTCAGGGTCGTCGGTGTTTGGCCAGCAGCCGCAACAGCAGCAGCCATCG
TCGGGCGGCGGGCTTTTTGGCCAGCAGACGCAGAATCAGACGAGCGGAAGCGGGCCGTTTGGTCAACCGGCGCAG
ACGCAGACGACGGGCGGTGGTCTTTTCGGCCAGCCGGCGCGGAATCAGTCGACGACGACGACGACGACGACGATG
GGCGGTGGTGGTGGTCTGTTTGGTCAGACGACCGCGACGGGCGGGAGCAGTCCTTTTGGTCAGCCGGCGCAAGCT
CAGGCTACGGCGACGGGCGGCGGTGGTCTCTTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGTGGTCTC
TTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGCCTCTTTGGCCAGCCTGCTTCGACTTCGACCACCGGT
CTCTTTGGCCAGCCTTCTCAGAACCAGACAAGCGGCGGCGGTGTCTTTGGTCAGCAGGCTCAGAATCAGCAGCAA
AAGCCCCCTTCCTCCTTTGGCGGTTCCACCCTCCAGGGCAGCGTTTTCGGGGCCCCGACGGCCAAACCCTCGCTC
TCGCTCTTTGGATCGACAACCGCCGACGCCAACGCTCAGCCTCAGCAAAATGCCTCCCTCTCATTTGGCAGCCTC
GCCCTCGGCGGTGGCCTCGCAGCCGCCCCGGCCCAGGCGCAGCAGCAACAGCAACAGCTCGCCGGCGCCTACTTC
GACAGCCTCTTCGCCAAGACGCTCAAGGAAGGAGGCGGCAAGACCAACATGGAATCTCTCCCCAGCCTGGAGCTC
GGCCTGGGCGACCTGCGCCATCGGCTGAGGAAGCTCCAGCACAAGTCCAACGAGAAGCCTCTTGACGGCAAGGCG
CACTACCTCCTGGCCGCGTCGGGCGTCGACCCCAGCATCGCCGCCAAGGACCTCGGCTTGCTCGACGTTCAGGGA
GCGCGCGTCGACCGGGCCAACGGCTACGCGCCGAGCGAGTTGGACGTCGAGACGTACCTCTCCAACCTGCAGACC
AAGACGACGCTGAGCATGATCTCGGACGACCTCGAGCGATCGCTGCGCGACTTTGACAATTTCCTCGAGGACCAT
GTGGCCATGGAATGGGACGCCCAGCGGAAACGCATCTATCAGCACTTTGGCATCAAACCGCGCCAAGACTCGGCC
GCTGCCCGAGACCCCCAGGCCGCTAGCTTCGGACGCTCACGCCGGAGCAAGAGCCACGGCGGAGGGTCCCGCGCC
GGCGGCCGCAGCACCGTGCTCGGCATGTCTTCGGCGCAGCGCTCCGTCATCGGGCCCCCGAGCCGCATCGGCGCT
CATCCGTCCGACTTTTCCGACGTCAAGGGCTCCCCGGACGCGTCCGGCGCTGCTCTCAAGACGCGCACTGCCACC
GAGCTCCGCGTCCTCCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGCGCTCTCAACGCGGCCCGTCTGGAC
AAACGCCCCTATGCCATCTTGGCCGAGCTGTGCGACGTGGTTCACAAGTCGCCCGAAGCCCACGCGCCGCACGTC
GTCGAGGCCTACCTCGCCATGATGGAGCTGGTGGGCGAGGACGAGTCCCTGATGGGCGAGCGCCGCTTTGCCGAA
CTGTACCTCGACGACAACGCCCAGTCGGCCGCCGCCGTCGACATGCGGAAGCGCATCTTGCACGGCGCCAACCGC
TTCCTCGAGCAGCAATTCATGCGCCATGTCGACTCTCTCATCGCCAAACACCCCCACGATGCCAAGCTCGGCGGC
CGGCCGGACGTGACGAGCAAGATCAGGGCCTACATCCGGCTGCGGTCTGCCCACAAGGACCTGGTGCCCGACAAC
ACGGAGCTGCAGCAGATGCAGGGCGAGTACGTCTGGGCCGTCGTCTTCTACCTCTTGCGGTCCGGCCACGTCAAG
GAAGCGGCCCAGTTCGTCAACGACAAGAGCGGCCAGTTCCGCGGCATCGACCGCACTTTTGGCACCTATCTCAAC
AACTACGCGAGCAGCGAGGATCGGCGCATCACTAACCGTAAGCTCCTCGATCGCTGCACGAACGAGTACGCTCAG
CGGGCCCGCAACGCGCCGGACCACTCCATCGACCCCTTTCGGATGGCCTGCTACAAGGTCATCGGCCGCATCGAG
CTCGGCAACCGCAACCTCGACGGCCTCCATACCGACATCAACGACTGGATCTGGCTGCAGTTCAACCTGGCCAGG
GAGGGCGACCGCTCCGTCGAGATGGCCGGCGAGTCGTACGGCCTGGCCGAGCTGCAGGCCAGCGTCCGCGACATC
GGCCTCAAGCACTTCCCCAAGGCCAGCGCCGCCGACGACGCCAACAACGGCAGCTTCGGCATGTTCTTCTACCTG
CAGATCCTCGCCGGCATGTTCGAGGACGCCGTCGCCTACCTCTACCCCTTTTCGTACGTCGACGCTGTCCACTTC
GCCCTGGCCTTGACCTACCACGGCCTCCTGCGGCCCAGCGACCCGACGTCGGGATCCAACGAGCTGCGCAGCCTC
AGCGTCAAAGACGTGCCGCAGATCAACTTTGGCCGGATGCTGGGCTACTACACGCGCGACTTCCGCGCCGCCGAC
GTCGTCTCCGCCGTCGATTATCTGGCCCTCATCTGCCTGAACCGAGACCTCGCCGGCGAGGCCGGACGGCGGCAG
GGCGCTCTGTGCCACGAGGCGCTGCGCGACCTGGTGCTGGAGACACGCGAGTTCAGCAAACTCCTTGGCGACATC
AGGCCGGACGGACGCGGCATCCGCGGCGTCATCGAGGAGCGGGCGCCGCTCATGGGGCTCGACGACGACGACGGT
CACTTCGTCGCCACGGTGACGTTGCAGGCGGCCAGTTTCGCCGACGAGACTGGTCGGACGACGGACGCGGTGCTG
CTGTATCATCTGGCGGGCGAGTACGACACCGTCGTGGCCATCGTCAGCCGAGCCCTCAGCGAGGCCGTGTCGCTG
GAGATGGGAGAGGACCCGATGCGGCTGGCGCCCGTCAAGCCGCGCGAGGCCGACGCCCAACAGGGCAGCAGCCTG
AGTCTGGCGGCCATCGACGACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGGGACGCCATGTTC
TACGGCAAGATCCAGGCGGAGAACAGGGTGGCCTGCCACGTGCTACTGGAGATGAGTGGCATCAAGAAGCTGGTT
GAGGCGGGACGCTGGGCCCAGGCCCTAGATAAGATTCGCGGACTCGAGATCCTGCCGCTCGACGCGGCGGGCGAC
GCGAGCACGATCCGGGCCTACGCCTCCAAGTTCTCGGCGCTGTCGCAGCCGGTGTCGATCAACGTGCCGAACCTG
CTGATGTGGACCATCATCTGCTGCCTGCGTCAGAGGGAGCAGCTCACCAACGGCCAGTTCAGCGGAAACGAGGGG
ACGAGACGCTTGATGGTGGACCAGCTGAAGCAGATGACGCTGGATCTGACGACGTACACGAGCCAGTTGCGGTAC
CGGTTTCCGCCGCACCTGCACGAGGCGCTGGCGAGGGCGTCGGCCGAG
Transcript >Ophio5|7084
ATGTCGGTCTTCGGGCAGCAGCCGGCCTCAGGGTCGTCGGTGTTTGGCCAGCAGCCGCAACAGCAGCAGCCATCG
TCGGGCGGCGGGCTTTTTGGCCAGCAGACGCAGAATCAGACGAGCGGAAGCGGGCCGTTTGGTCAACCGGCGCAG
ACGCAGACGACGGGCGGTGGTCTTTTCGGCCAGCCGGCGCGGAATCAGTCGACGACGACGACGACGACGACGATG
GGCGGTGGTGGTGGTCTGTTTGGTCAGACGACCGCGACGGGCGGGAGCAGTCCTTTTGGTCAGCCGGCGCAAGCT
CAGGCTACGGCGACGGGCGGCGGTGGTCTCTTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGTGGTCTC
TTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGCCTCTTTGGCCAGCCTGCTTCGACTTCGACCACCGGT
CTCTTTGGCCAGCCTTCTCAGAACCAGACAAGCGGCGGCGGTGTCTTTGGTCAGCAGGCTCAGAATCAGCAGCAA
AAGCCCCCTTCCTCCTTTGGCGGTTCCACCCTCCAGGGCAGCGTTTTCGGGGCCCCGACGGCCAAACCCTCGCTC
TCGCTCTTTGGATCGACAACCGCCGACGCCAACGCTCAGCCTCAGCAAAATGCCTCCCTCTCATTTGGCAGCCTC
GCCCTCGGCGGTGGCCTCGCAGCCGCCCCGGCCCAGGCGCAGCAGCAACAGCAACAGCTCGCCGGCGCCTACTTC
GACAGCCTCTTCGCCAAGACGCTCAAGGAAGGAGGCGGCAAGACCAACATGGAATCTCTCCCCAGCCTGGAGCTC
GGCCTGGGCGACCTGCGCCATCGGCTGAGGAAGCTCCAGCACAAGTCCAACGAGAAGCCTCTTGACGGCAAGGCG
CACTACCTCCTGGCCGCGTCGGGCGTCGACCCCAGCATCGCCGCCAAGGACCTCGGCTTGCTCGACGTTCAGGGA
GCGCGCGTCGACCGGGCCAACGGCTACGCGCCGAGCGAGTTGGACGTCGAGACGTACCTCTCCAACCTGCAGACC
AAGACGACGCTGAGCATGATCTCGGACGACCTCGAGCGATCGCTGCGCGACTTTGACAATTTCCTCGAGGACCAT
GTGGCCATGGAATGGGACGCCCAGCGGAAACGCATCTATCAGCACTTTGGCATCAAACCGCGCCAAGACTCGGCC
GCTGCCCGAGACCCCCAGGCCGCTAGCTTCGGACGCTCACGCCGGAGCAAGAGCCACGGCGGAGGGTCCCGCGCC
GGCGGCCGCAGCACCGTGCTCGGCATGTCTTCGGCGCAGCGCTCCGTCATCGGGCCCCCGAGCCGCATCGGCGCT
CATCCGTCCGACTTTTCCGACGTCAAGGGCTCCCCGGACGCGTCCGGCGCTGCTCTCAAGACGCGCACTGCCACC
GAGCTCCGCGTCCTCCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGCGCTCTCAACGCGGCCCGTCTGGAC
AAACGCCCCTATGCCATCTTGGCCGAGCTGTGCGACGTGGTTCACAAGTCGCCCGAAGCCCACGCGCCGCACGTC
GTCGAGGCCTACCTCGCCATGATGGAGCTGGTGGGCGAGGACGAGTCCCTGATGGGCGAGCGCCGCTTTGCCGAA
CTGTACCTCGACGACAACGCCCAGTCGGCCGCCGCCGTCGACATGCGGAAGCGCATCTTGCACGGCGCCAACCGC
TTCCTCGAGCAGCAATTCATGCGCCATGTCGACTCTCTCATCGCCAAACACCCCCACGATGCCAAGCTCGGCGGC
CGGCCGGACGTGACGAGCAAGATCAGGGCCTACATCCGGCTGCGGTCTGCCCACAAGGACCTGGTGCCCGACAAC
ACGGAGCTGCAGCAGATGCAGGGCGAGTACGTCTGGGCCGTCGTCTTCTACCTCTTGCGGTCCGGCCACGTCAAG
GAAGCGGCCCAGTTCGTCAACGACAAGAGCGGCCAGTTCCGCGGCATCGACCGCACTTTTGGCACCTATCTCAAC
AACTACGCGAGCAGCGAGGATCGGCGCATCACTAACCGTAAGCTCCTCGATCGCTGCACGAACGAGTACGCTCAG
CGGGCCCGCAACGCGCCGGACCACTCCATCGACCCCTTTCGGATGGCCTGCTACAAGGTCATCGGCCGCATCGAG
CTCGGCAACCGCAACCTCGACGGCCTCCATACCGACATCAACGACTGGATCTGGCTGCAGTTCAACCTGGCCAGG
GAGGGCGACCGCTCCGTCGAGATGGCCGGCGAGTCGTACGGCCTGGCCGAGCTGCAGGCCAGCGTCCGCGACATC
GGCCTCAAGCACTTCCCCAAGGCCAGCGCCGCCGACGACGCCAACAACGGCAGCTTCGGCATGTTCTTCTACCTG
CAGATCCTCGCCGGCATGTTCGAGGACGCCGTCGCCTACCTCTACCCCTTTTCGTACGTCGACGCTGTCCACTTC
GCCCTGGCCTTGACCTACCACGGCCTCCTGCGGCCCAGCGACCCGACGTCGGGATCCAACGAGCTGCGCAGCCTC
AGCGTCAAAGACGTGCCGCAGATCAACTTTGGCCGGATGCTGGGCTACTACACGCGCGACTTCCGCGCCGCCGAC
GTCGTCTCCGCCGTCGATTATCTGGCCCTCATCTGCCTGAACCGAGACCTCGCCGGCGAGGCCGGACGGCGGCAG
GGCGCTCTGTGCCACGAGGCGCTGCGCGACCTGGTGCTGGAGACACGCGAGTTCAGCAAACTCCTTGGCGACATC
AGGCCGGACGGACGCGGCATCCGCGGCGTCATCGAGGAGCGGGCGCCGCTCATGGGGCTCGACGACGACGACGGT
CACTTCGTCGCCACGGTGACGTTGCAGGCGGCCAGTTTCGCCGACGAGACTGGTCGGACGACGGACGCGGTGCTG
CTGTATCATCTGGCGGGCGAGTACGACACCGTCGTGGCCATCGTCAGCCGAGCCCTCAGCGAGGCCGTGTCGCTG
GAGATGGGAGAGGACCCGATGCGGCTGGCGCCCGTCAAGCCGCGCGAGGCCGACGCCCAACAGGGCAGCAGCCTG
AGTCTGGCGGCCATCGACGACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGGGACGCCATGTTC
TACGGCAAGATCCAGGCGGAGAACAGGGTGGCCTGCCACGTGCTACTGGAGATGAGTGGCATCAAGAAGCTGGTT
GAGGCGGGACGCTGGGCCCAGGCCCTAGATAAGATTCGCGGACTCGAGATCCTGCCGCTCGACGCGGCGGGCGAC
GCGAGCACGATCCGGGCCTACGCCTCCAAGTTCTCGGCGCTGTCGCAGCCGGTGTCGATCAACGTGCCGAACCTG
CTGATGTGGACCATCATCTGCTGCCTGCGTCAGAGGGAGCAGCTCACCAACGGCCAGTTCAGCGGAAACGAGGGG
ACGAGACGCTTGATGGTGGACCAGCTGAAGCAGATGACGCTGGATCTGACGACGTACACGAGCCAGTTGCGGTAC
CGGTTTCCGCCGCACCTGCACGAGGCGCTGGCGAGGGCGTCGGCCGAGTAG
Gene >Ophio5|7084
ATGTCGGTCTTCGGGCAGCAGCCGGCCTCAGGGTCGTCGGTGTTTGGCCAGCAGCCGCAACAGCAGCAGCCATCG
TCGGGCGGCGGGCTTTTTGGCCAGCAGACGCAGAATCAGACGAGCGGAAGCGGGCCGTTTGGTCAACCGGCGCAG
ACGCAGACGACGGGCGGTGGTCTTTTCGGCCAGCCGGCGCGGAATCAGTCGACGACGACGACGACGACGACGATG
GGCGGTGGTGGTGGTCTGTTTGGTCAGACGACCGCGACGGGCGGGAGCAGTCCTTTTGGTCAGCCGGCGCAAGCT
CAGGCTACGGCGACGGGCGGCGGTGGTCTCTTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGTGGTCTC
TTCGGTCAGCCGGCCCAGAACCAGACGACGGGCGGTGGCCTCTTTGGCCAGCCTGCTTCGACTTCGACCACCGGT
CTCTTTGGCCAGCCTTCTCAGAACCAGACAAGCGGCGGCGGTGTCTTTGGTCAGCAGGCTCAGAATCAGCAGCAA
AAGCCCCCTTCCTCCTTTGGCGGTTCCACCCTCCAGGGCAGCGTTTTCGGGGCCCCGACGGCCAAACCCTCGCTC
TCGCTCTTTGGATCGACAACCGCCGACGCCAACGCTCAGCCTCAGCAAAATGCCTCCCTCTCATTTGGCAGCCTC
GCCCTCGGCGGTGGCCTCGCAGCCGCCCCGGCCCAGGCGCAGCAGCAACAGCAACAGCTCGCCGGCGCCTACTTC
GACAGCCTCTTCGCCAAGACGCTCAAGGAAGGAGGCGGCAAGACCAACATGGAATCTCTCCCCAGCCTGGAGCTC
GGCCTGGGCGACCTGCGCCATCGGCTGAGGAAGCTCCAGCACAAGTCCAACGAGAAGCCTCTTGACGGCAAGGCG
CACTACCTCCTGGCCGCGTCGGGCGTCGACCCCAGCATCGCCGCCAAGGACCTCGGCTTGCTCGACGTTCAGGGA
GCGCGCGTCGACCGGGCCAACGGCTACGCGCCGAGCGAGTTGGACGTCGAGACGTACCTCTCCAACCTGCAGACC
AAGACGACGCTGAGCATGATCTCGGACGACCTCGAGCGATCGCTGCGCGACTTTGACAATTTCCTCGAGGACCAT
GTGGCCATGGAATGGGACGCCCAGCGGAAACGCATCTATCAGCACTTTGGCATCAAACCGCGCCAAGACTCGGCC
GCTGCCCGAGACCCCCAGGCCGCTAGCTTCGGACGCTCACGCCGGAGCAAGAGCCACGGCGGAGGGTCCCGCGCC
GGCGGCCGCAGCACCGTGCTCGGCATGTCTTCGGCGCAGCGCTCCGTCATCGGGCCCCCGAGCCGCATCGGCGCT
CATCCGTCCGACTTTTCCGACGTCAAGGGCTCCCCGGACGCGTCCGGCGCTGCTCTCAAGACGCGCACTGCCACC
GAGCTCCGCGTCCTCCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGCGCTCTCAACGCGGCCCGTCTGGAC
AAACGCCCCTATGCCATCTTGGCCGAGCTGTGCGACGTGGTTCACAAGTCGCCCGAAGCCCACGCGCCGCACGTC
GTCGAGGCCTACCTCGCCATGATGGAGCTGGTGGGCGAGGACGAGTCCCTGATGGGCGAGCGCCGCTTTGCCGAA
CTGTACCTCGACGACAACGCCCAGTCGGCCGCCGCCGTCGACATGCGGAAGCGCATCTTGCACGGCGCCAACCGC
TTCCTCGAGCAGCAATTCATGCGCCATGTCGACTCTCTCATCGCCAAACACCCCCACGATGCCAAGCTCGGCGGC
CGGCCGGACGTGACGAGCAAGATCAGGGCCTACATCCGGCTGCGGTCTGCCCACAAGGACCTGGTGCCCGACAAC
ACGGAGCTGCAGCAGATGCAGGGCGAGTACGTCTGGGCCGTCGTCTTCTACCTCTTGCGGTCCGGCCACGTCAAG
GAAGCGGCCCAGTTCGTCAACGACAAGAGCGGCCAGTTCCGCGGCATCGACCGCACTTTTGGCACCTATCTCAAC
AACTACGCGAGCAGCGAGGATCGGCGCATCACTAACCGTAAGCTCCTCGATCGCTGCACGAACGAGTACGCTCAG
CGGGCCCGCAACGCGCCGGACCACTCCATCGACCCCTTTCGGATGGCCTGCTACAAGGTCATCGGCCGCATCGAG
CTCGGCAACCGCAACCTCGACGGCCTCCATACCGACATCAACGACTGGATCTGGCTGCAGTTCAACCTGGCCAGG
GAGGGCGACCGCTCCGTCGAGATGGCCGGCGAGTCGTACGGCCTGGCCGAGCTGCAGGCCAGCGTCCGCGACATC
GGCCTCAAGCACTTCCCCAAGGCCAGCGCCGCCGACGACGCCAACAACGGCAGCTTCGGCATGTTCTTCTACCTG
CAGATCCTCGCCGGCATGTTCGAGGACGCCGTCGCCTACCTCTACCCCTTTTCGTACGTCGACGCTGTCCACTTC
GCCCTGGCCTTGACCTACCACGGCCTCCTGCGGCCCAGCGACCCGACGTCGGGATCCAACGAGCTGCGCAGCCTC
AGCGTCAAAGACGTGCCGCAGATCAACTTTGGCCGGATGCTGGGCTACTACACGCGCGACTTCCGCGCCGCCGAC
GTCGTCTCCGCCGTCGATTATCTGGCCCTCATCTGCCTGAACCGAGACCTCGCCGGCGAGGCCGGACGGCGGCAG
GGCGCTCTGTGCCACGAGGCGCTGCGCGACCTGGTGCTGGAGACACGCGAGTTCAGCAAACTCCTTGGCGACATC
AGGCCGGACGGACGCGGCATCCGCGGCGTCATCGAGGAGCGGGCGCCGCTCATGGGGCTCGACGACGACGACGGT
CACTTCGTCGCCACGGTGACGTTGCAGGCGGCCAGTTTCGCCGACGAGACTGGTCGGACGACGGACGCGGTGCTG
CTGTATCATCTGGCGGGCGAGTACGACACCGTCGTGGCCATCGTCAGCCGAGCCCTCAGCGAGGCCGTGTCGCTG
GAGATGGGAGAGGACCCGATGCGGCTGGCGCCCGTCAAGCCGCGCGAGGCCGACGCCCAACAGGGCAGCAGCCTG
AGTCTGGCGGCCATCGACGACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGGGACGCCATGTTC
TACGGCAAGATCCAGGCGGAGAACAGGGTGGCCTGCCACGTGCTACTGGAGATGAGTGGCATCAAGAAGCTGGTT
GAGGCGGGACGCTGGGCCCAGGCCCTAGATGTACAGTCACGCCCCCAGTAGGATCCTCCGAGGGAACGGAACGCT
ATGTACTGACTGGTTGCTGCAGAAGATTCGCGGACTCGAGATCCTGCCGCTCGACGCGGCGGGCGACGCGAGCAC
GATCCGGGCCTACGCCTCCAAGTTCTCGGCGCTGTCGCAGCCGGTGTCGATCAACGTGCCGAACCTGCTGATGTG
GACCATCATCTGCTGCCTGCGTCAGAGGGAGCAGCTCACCAACGGCCAGTTCAGCGGAAACGAGGGGACGAGACG
CTTGATGGTGGACCAGCTGAAGCAGATGACGCTGGATCTGACGACGTACACGAGCCAGTTGCGGTACCGGTTTCC
GCCGCACCTGCACGAGGCGCTGGCGAGGGCGTCGGCCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail