Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7077
Gene name
Locationscaffold_658:6583..7144
Strand-
Gene length (bp)561
Transcript length (bp)561
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00829 Ribosomal_L21p Ribosomal prokaryotic L21 protein 4.1E-13 60 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7D4|ACON2_SCHPO Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 23 165 3.0E-23
sp|P40858|RN49_YEAST 54S ribosomal protein L49, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL49 PE=1 SV=2 53 165 3.0E-20

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7077
MINIPLPRPPPPEPKNAPNPTEGLVRPLALKKSHPKAPPTPIADSVRRLLPVLAAQPEHYITVHIHGFPYLVQEG
DQIRLPFRMPGVVPGDVLRLNRASVLGSRDYTMKGAPHIDERVFVCRATVLGTESEPMRIKIKKKRRCRKKRQAK
SKLRYTMLRISELSVVTPPAEEAAAEGDAAEREPAA
Coding >Ophio5|7077
ATGATCAACATCCCACTGCCTCGGCCTCCTCCACCAGAACCCAAGAACGCGCCCAACCCGACAGAGGGACTGGTC
CGGCCGCTCGCGTTGAAGAAGAGCCATCCGAAGGCGCCGCCGACGCCCATTGCCGACTCGGTCCGGCGGCTACTG
CCCGTGCTGGCGGCGCAGCCGGAACACTACATTACCGTTCACATCCACGGCTTTCCTTACCTCGTGCAGGAAGGC
GATCAGATTCGACTACCTTTTCGCATGCCCGGCGTTGTTCCCGGCGATGTGCTTCGCTTGAATCGTGCCAGCGTG
CTGGGCAGCCGCGATTACACGATGAAGGGGGCGCCGCACATCGATGAGCGGGTCTTTGTGTGCCGCGCCACTGTC
CTCGGGACCGAATCGGAGCCGATGCGCATCAAGATTAAAAAGAAGCGGCGGTGTCGCAAGAAGCGTCAGGCGAAA
TCCAAGCTCCGCTACACCATGTTGCGGATATCCGAGCTCAGCGTTGTCACGCCGCCTGCTGAGGAAGCTGCAGCT
GAGGGAGATGCGGCCGAGAGAGAGCCAGCTGCA
Transcript >Ophio5|7077
ATGATCAACATCCCACTGCCTCGGCCTCCTCCACCAGAACCCAAGAACGCGCCCAACCCGACAGAGGGACTGGTC
CGGCCGCTCGCGTTGAAGAAGAGCCATCCGAAGGCGCCGCCGACGCCCATTGCCGACTCGGTCCGGCGGCTACTG
CCCGTGCTGGCGGCGCAGCCGGAACACTACATTACCGTTCACATCCACGGCTTTCCTTACCTCGTGCAGGAAGGC
GATCAGATTCGACTACCTTTTCGCATGCCCGGCGTTGTTCCCGGCGATGTGCTTCGCTTGAATCGTGCCAGCGTG
CTGGGCAGCCGCGATTACACGATGAAGGGGGCGCCGCACATCGATGAGCGGGTCTTTGTGTGCCGCGCCACTGTC
CTCGGGACCGAATCGGAGCCGATGCGCATCAAGATTAAAAAGAAGCGGCGGTGTCGCAAGAAGCGTCAGGCGAAA
TCCAAGCTCCGCTACACCATGTTGCGGATATCCGAGCTCAGCGTTGTCACGCCGCCTGCTGAGGAAGCTGCAGCT
GAGGGAGATGCGGCCGAGAGAGAGCCAGCTGCATGA
Gene >Ophio5|7077
ATGATCAACATCCCACTGCCTCGGCCTCCTCCACCAGAACCCAAGAACGCGCCCAACCCGACAGAGGGACTGGTC
CGGCCGCTCGCGTTGAAGAAGAGCCATCCGAAGGCGCCGCCGACGCCCATTGCCGACTCGGTCCGGCGGCTACTG
CCCGTGCTGGCGGCGCAGCCGGAACACTACATTACCGTTCACATCCACGGCTTTCCTTACCTCGTGCAGGAAGGC
GATCAGATTCGACTACCTTTTCGCATGCCCGGCGTTGTTCCCGGCGATGTGCTTCGCTTGAATCGTGCCAGCGTG
CTGGGCAGCCGCGATTACACGATGAAGGGGGCGCCGCACATCGATGAGCGGGTCTTTGTGTGCCGCGCCACTGTC
CTCGGGACCGAATCGGAGCCGATGCGCATCAAGATTAAAAAGAAGCGGCGGTGTCGCAAGAAGCGTCAGGCGAAA
TCCAAGCTCCGCTACACCATGTTGCGGATATCCGAGCTCAGCGTTGTCACGCCGCCTGCTGAGGAAGCTGCAGCT
GAGGGAGATGCGGCCGAGAGAGAGCCAGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail