Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7070
Gene name
Locationscaffold_656:5960..9516
Strand-
Gene length (bp)3556
Transcript length (bp)3039
Coding sequence length (bp)3036
Protein length (aa) 1012

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06032 DUF917 Protein of unknown function (DUF917) 2.2E-117 623 990
PF05378 Hydant_A_N Hydantoinase/oxoprolinase N-terminal region 6.7E-25 5 183
PF01968 Hydantoinase_A Hydantoinase/oxoprolinase 1.7E-17 205 392

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01262|HYUA_PSESN Hydantoin utilization protein A OS=Pseudomonas sp. (strain NS671) GN=hyuA PE=3 SV=1 6 393 8.0E-13

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7070
MSSYRIGVDVGGTNTDAAILDISALDQPGRGVLASHKTLTTADITSGIEAAIRAVLADSGVDQDHVLSVTIGTTH
FINALVEADARRLDRVAVIRLCGPFTRQLPPFSGFPVGLRRIIEGGLHYIDGGLEMNGREIAPLDPHQIRRVAAE
IVAAGISAVALVGVFSPLDHDGIHEERCRELLLREAPGLRVVCSRSIGSTGLLERENATILNAAILRTARHVKRG
FRRAMGRLRLRCPLFLSQNDGTLIDADVAAELPIKTFASGPTNSMTGAAFLAGIDRAAPAADAEGPQVLVVDIGG
TTTDICALLPSGFPRQAPGFVDVGGVRTAFSMPEVLSVGLGGGSKVVVTPDPHRPGFDLVSVGPASVGHRLREEA
RVFGGSTLTATDAIAAAGGNDLGDAALVADVPRTTIDLACQDIRHKLETIIDRMRVSAAPVHVLLVGGGAILVRE
ELAGVDKCIRPVHQGAANAVGAAIAKVSGEVDSLEILGRRQEREIIDAACSRAVDLAVEKGASRDDVRVVEINKT
PLQYMSQETIRIQVRAVGKLAIPVGPAPSRSSAGDAEPPVTGEADDDRDEDDDDDNDDAPKVSIPDALEPTTKPT
LGVDLATYRPDVRAGVWYVSEIDLELIATGCGVLGTGGGGPTYYEYLKCLNSRRGPGGDKMRIISAQSLADDDVV
CFGAWYGSPSVINERIPGGNEIAAAIDAVNLIKGNDSFAALCLDEIGGGNGMCALPNCVRYDCPVIDGDAMGRAY
PTLYHTSFCVYGYSMTPCTVTDAAGNVVVATKTDNPFRLETLIRTASVEMGLSCASSPNPLPASAVKAHGVPNTI
SQAWYLGRAVHMARRSKANYVDAIFSVCDGKLLFTGKITDVHRYIGGGYTMGAVLLAPLSDEERESPANASRQQV
PTDKHMIIPFQNEYLYAAHCDALGSEPSREVVCTVPSLISILGQDGEAIGSQDLRYGLRVNVIALPAHPLWRTPE
ALKVGGPEGFGLNMPEVGVETCEEFKGARSVIDEFRE
Coding >Ophio5|7070
ATGTCGTCATACCGGATCGGCGTCGACGTCGGCGGCACCAACACGGATGCCGCCATCCTTGACATCAGCGCCCTC
GACCAGCCCGGACGCGGCGTGTTGGCCTCACACAAGACCTTGACGACGGCCGACATTACCAGCGGCATCGAGGCC
GCGATCCGGGCCGTATTGGCGGACTCGGGCGTCGACCAGGACCACGTCCTCAGCGTCACCATCGGCACGACACAC
TTTATCAACGCCCTGGTCGAGGCCGATGCCCGCCGGCTCGATCGCGTGGCCGTCATCCGACTCTGCGGGCCCTTT
ACGCGCCAGCTGCCTCCCTTTTCCGGCTTCCCGGTTGGCCTCAGACGGATCATTGAGGGCGGCCTTCACTACATC
GATGGCGGGCTGGAGATGAACGGCCGGGAGATCGCACCTCTGGACCCGCATCAGATCCGGCGCGTGGCCGCAGAG
ATAGTGGCCGCCGGCATCTCCGCCGTCGCCCTCGTAGGCGTCTTCTCGCCCCTGGACCACGACGGCATCCACGAG
GAGCGGTGCCGTGAGCTGCTTCTGCGAGAGGCGCCCGGTCTACGCGTCGTCTGCTCTCGTAGCATCGGCTCAACC
GGCCTCCTGGAGCGTGAGAACGCGACGATTCTGAACGCGGCCATCCTTCGCACCGCCCGTCACGTCAAGCGTGGC
TTCAGACGCGCCATGGGCCGTCTCCGTCTGCGTTGTCCCTTGTTTCTGTCGCAGAATGACGGCACGCTCATCGAC
GCCGACGTCGCCGCCGAGCTGCCCATCAAGACTTTTGCCAGCGGGCCGACCAACAGTATGACGGGCGCCGCCTTT
CTAGCCGGCATCGACCGCGCTGCCCCCGCTGCCGACGCCGAGGGCCCCCAGGTGCTGGTGGTGGACATTGGCGGC
ACTACGACGGACATCTGCGCCCTGCTACCCTCGGGCTTCCCCCGTCAGGCACCGGGCTTCGTCGACGTCGGCGGG
GTCCGGACCGCTTTTTCTATGCCCGAGGTCCTCTCCGTCGGTCTCGGCGGCGGAAGCAAAGTGGTCGTGACGCCG
GACCCACACCGGCCCGGCTTCGACCTCGTCTCCGTCGGCCCGGCCTCGGTCGGCCACCGGCTCCGGGAGGAGGCC
CGCGTCTTCGGCGGATCGACGCTGACGGCAACCGACGCCATCGCGGCCGCCGGCGGCAATGACCTCGGCGACGCC
GCCCTCGTCGCCGACGTACCCCGGACCACCATTGACCTCGCCTGCCAAGACATACGGCACAAGCTCGAGACCATC
ATCGACCGTATGAGGGTCTCTGCCGCGCCTGTCCACGTGCTACTCGTCGGTGGCGGCGCCATCCTCGTCAGGGAA
GAGCTGGCCGGTGTGGACAAGTGCATCCGTCCCGTTCATCAGGGCGCGGCCAACGCCGTCGGAGCGGCCATCGCA
AAGGTCTCGGGCGAGGTCGATAGTCTCGAGATTTTGGGCCGTAGGCAAGAGAGGGAGATTATCGACGCTGCCTGC
AGCCGTGCTGTCGACCTGGCCGTCGAAAAGGGCGCCAGCCGTGACGACGTACGAGTCGTCGAGATCAATAAGACG
CCTCTTCAGTACATGTCGCAGGAGACGATCCGCATCCAGGTCCGCGCCGTCGGTAAGCTCGCCATCCCGGTCGGC
CCTGCTCCGAGCCGGTCAAGTGCTGGAGATGCGGAGCCTCCGGTGACGGGCGAGGCCGACGACGACCGAGACGAA
GATGATGATGACGACAACGACGACGCACCCAAGGTCAGCATCCCCGACGCCCTAGAACCAACCACCAAGCCGACG
CTCGGCGTGGACCTGGCCACATACCGGCCGGACGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATCGATCTTGAG
CTCATCGCCACCGGCTGCGGCGTCCTCGGCACCGGCGGCGGCGGCCCGACTTACTACGAGTATCTCAAGTGTCTC
AACAGCCGTCGCGGACCGGGCGGTGACAAGATGAGGATCATCTCGGCCCAGTCGCTCGCCGACGACGACGTCGTC
TGCTTCGGCGCCTGGTACGGCAGTCCGAGCGTCATCAACGAGCGTATCCCGGGCGGCAACGAGATCGCCGCTGCC
ATCGACGCCGTTAATCTCATCAAGGGGAACGACTCCTTTGCCGCTCTCTGCCTCGACGAGATCGGAGGCGGCAAC
GGCATGTGTGCCTTGCCCAATTGCGTACGCTACGACTGCCCCGTAATCGACGGCGATGCCATGGGACGAGCCTAT
CCAACCCTGTACCACACCAGCTTCTGCGTCTACGGCTACAGCATGACGCCTTGTACCGTCACAGATGCCGCCGGC
AACGTCGTCGTGGCTACCAAAACCGATAACCCCTTCCGCCTCGAGACGCTCATCCGAACGGCATCCGTCGAGATG
GGCTTGTCGTGCGCATCGAGTCCTAATCCGCTTCCAGCATCGGCCGTCAAGGCGCATGGCGTGCCAAACACCATA
TCGCAGGCCTGGTATCTGGGCCGAGCTGTGCACATGGCCAGGCGTAGTAAGGCGAACTATGTAGATGCCATTTTC
AGCGTCTGCGACGGAAAGCTGCTCTTCACGGGGAAGATCACCGACGTCCACCGCTATATCGGCGGCGGGTATACC
ATGGGCGCCGTCCTGCTCGCCCCTCTGAGTGACGAGGAGCGCGAATCGCCAGCCAACGCCAGCCGCCAACAAGTC
CCAACAGACAAGCACATGATCATTCCGTTCCAGAACGAGTATCTGTACGCCGCTCACTGCGATGCACTGGGATCC
GAGCCGTCGAGGGAGGTCGTATGCACCGTCCCGAGTCTCATCTCCATCTTGGGCCAAGACGGCGAGGCCATTGGA
TCTCAAGACTTGCGGTACGGTCTCCGCGTCAACGTCATCGCCCTGCCGGCGCATCCGCTATGGCGAACTCCGGAA
GCACTGAAGGTAGGTGGCCCGGAGGGCTTCGGCTTGAACATGCCCGAAGTCGGTGTCGAGACGTGCGAAGAGTTT
AAGGGGGCAAGGAGCGTCATAGACGAATTTAGGGAG
Transcript >Ophio5|7070
ATGTCGTCATACCGGATCGGCGTCGACGTCGGCGGCACCAACACGGATGCCGCCATCCTTGACATCAGCGCCCTC
GACCAGCCCGGACGCGGCGTGTTGGCCTCACACAAGACCTTGACGACGGCCGACATTACCAGCGGCATCGAGGCC
GCGATCCGGGCCGTATTGGCGGACTCGGGCGTCGACCAGGACCACGTCCTCAGCGTCACCATCGGCACGACACAC
TTTATCAACGCCCTGGTCGAGGCCGATGCCCGCCGGCTCGATCGCGTGGCCGTCATCCGACTCTGCGGGCCCTTT
ACGCGCCAGCTGCCTCCCTTTTCCGGCTTCCCGGTTGGCCTCAGACGGATCATTGAGGGCGGCCTTCACTACATC
GATGGCGGGCTGGAGATGAACGGCCGGGAGATCGCACCTCTGGACCCGCATCAGATCCGGCGCGTGGCCGCAGAG
ATAGTGGCCGCCGGCATCTCCGCCGTCGCCCTCGTAGGCGTCTTCTCGCCCCTGGACCACGACGGCATCCACGAG
GAGCGGTGCCGTGAGCTGCTTCTGCGAGAGGCGCCCGGTCTACGCGTCGTCTGCTCTCGTAGCATCGGCTCAACC
GGCCTCCTGGAGCGTGAGAACGCGACGATTCTGAACGCGGCCATCCTTCGCACCGCCCGTCACGTCAAGCGTGGC
TTCAGACGCGCCATGGGCCGTCTCCGTCTGCGTTGTCCCTTGTTTCTGTCGCAGAATGACGGCACGCTCATCGAC
GCCGACGTCGCCGCCGAGCTGCCCATCAAGACTTTTGCCAGCGGGCCGACCAACAGTATGACGGGCGCCGCCTTT
CTAGCCGGCATCGACCGCGCTGCCCCCGCTGCCGACGCCGAGGGCCCCCAGGTGCTGGTGGTGGACATTGGCGGC
ACTACGACGGACATCTGCGCCCTGCTACCCTCGGGCTTCCCCCGTCAGGCACCGGGCTTCGTCGACGTCGGCGGG
GTCCGGACCGCTTTTTCTATGCCCGAGGTCCTCTCCGTCGGTCTCGGCGGCGGAAGCAAAGTGGTCGTGACGCCG
GACCCACACCGGCCCGGCTTCGACCTCGTCTCCGTCGGCCCGGCCTCGGTCGGCCACCGGCTCCGGGAGGAGGCC
CGCGTCTTCGGCGGATCGACGCTGACGGCAACCGACGCCATCGCGGCCGCCGGCGGCAATGACCTCGGCGACGCC
GCCCTCGTCGCCGACGTACCCCGGACCACCATTGACCTCGCCTGCCAAGACATACGGCACAAGCTCGAGACCATC
ATCGACCGTATGAGGGTCTCTGCCGCGCCTGTCCACGTGCTACTCGTCGGTGGCGGCGCCATCCTCGTCAGGGAA
GAGCTGGCCGGTGTGGACAAGTGCATCCGTCCCGTTCATCAGGGCGCGGCCAACGCCGTCGGAGCGGCCATCGCA
AAGGTCTCGGGCGAGGTCGATAGTCTCGAGATTTTGGGCCGTAGGCAAGAGAGGGAGATTATCGACGCTGCCTGC
AGCCGTGCTGTCGACCTGGCCGTCGAAAAGGGCGCCAGCCGTGACGACGTACGAGTCGTCGAGATCAATAAGACG
CCTCTTCAGTACATGTCGCAGGAGACGATCCGCATCCAGGTCCGCGCCGTCGGTAAGCTCGCCATCCCGGTCGGC
CCTGCTCCGAGCCGGTCAAGTGCTGGAGATGCGGAGCCTCCGGTGACGGGCGAGGCCGACGACGACCGAGACGAA
GATGATGATGACGACAACGACGACGCACCCAAGGTCAGCATCCCCGACGCCCTAGAACCAACCACCAAGCCGACG
CTCGGCGTGGACCTGGCCACATACCGGCCGGACGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATCGATCTTGAG
CTCATCGCCACCGGCTGCGGCGTCCTCGGCACCGGCGGCGGCGGCCCGACTTACTACGAGTATCTCAAGTGTCTC
AACAGCCGTCGCGGACCGGGCGGTGACAAGATGAGGATCATCTCGGCCCAGTCGCTCGCCGACGACGACGTCGTC
TGCTTCGGCGCCTGGTACGGCAGTCCGAGCGTCATCAACGAGCGTATCCCGGGCGGCAACGAGATCGCCGCTGCC
ATCGACGCCGTTAATCTCATCAAGGGGAACGACTCCTTTGCCGCTCTCTGCCTCGACGAGATCGGAGGCGGCAAC
GGCATGTGTGCCTTGCCCAATTGCGTACGCTACGACTGCCCCGTAATCGACGGCGATGCCATGGGACGAGCCTAT
CCAACCCTGTACCACACCAGCTTCTGCGTCTACGGCTACAGCATGACGCCTTGTACCGTCACAGATGCCGCCGGC
AACGTCGTCGTGGCTACCAAAACCGATAACCCCTTCCGCCTCGAGACGCTCATCCGAACGGCATCCGTCGAGATG
GGCTTGTCGTGCGCATCGAGTCCTAATCCGCTTCCAGCATCGGCCGTCAAGGCGCATGGCGTGCCAAACACCATA
TCGCAGGCCTGGTATCTGGGCCGAGCTGTGCACATGGCCAGGCGTAGTAAGGCGAACTATGTAGATGCCATTTTC
AGCGTCTGCGACGGAAAGCTGCTCTTCACGGGGAAGATCACCGACGTCCACCGCTATATCGGCGGCGGGTATACC
ATGGGCGCCGTCCTGCTCGCCCCTCTGAGTGACGAGGAGCGCGAATCGCCAGCCAACGCCAGCCGCCAACAAGTC
CCAACAGACAAGCACATGATCATTCCGTTCCAGAACGAGTATCTGTACGCCGCTCACTGCGATGCACTGGGATCC
GAGCCGTCGAGGGAGGTCGTATGCACCGTCCCGAGTCTCATCTCCATCTTGGGCCAAGACGGCGAGGCCATTGGA
TCTCAAGACTTGCGGTACGGTCTCCGCGTCAACGTCATCGCCCTGCCGGCGCATCCGCTATGGCGAACTCCGGAA
GCACTGAAGGTAGGTGGCCCGGAGGGCTTCGGCTTGAACATGCCCGAAGTCGGTGTCGAGACGTGCGAAGAGTTT
AAGGGGGCAAGGAGCGTCATAGACGAATTTAGGGAGTAA
Gene >Ophio5|7070
ATGTCGTCATACCGGATCGGCGTCGACGTCGGCGGCACCAACACGGATGCCGCCATCCTTGACATCAGCGCCCTC
GACCAGCCCGGACGCGGCGTGTTGGCCTCACACAAGACCTTGACGACGGCCGACATTACCAGCGGCATCGAGGCC
GCGATCCGGGCCGTATTGGCGGACTCGGGCGTCGACCAGGACCACGTCCTCAGCGTCACCATCGGCACGACACAC
TTTATCAACGCCCTGGTCGAGGCCGATGCCCGCCGGCTCGATCGCGTGGCCGTCATCCGACTCTGCGGGCCCTTT
ACGCGCCAGCTGCCTCCCTTTTCCGGCTTCCCGGTTGGCCTCAGACGGATCATTGAGGGCGGCCTTCACTACATC
GATGGCGGGCTGGAGATGAACGGCCGGGAGATCGCACCTCTGGACCCGCATCAGATCCGGCGCGTGGCCGCAGAG
ATAGTGGCCGCCGGCATCTCCGCCGTCGCCCTCGTAGGCGTCTTCTCGCCCCTGGACCACGACGGCATCCACGAG
GAGCGGTGCCGTGAGCTGCTTCTGCGAGAGGCGCCCGGTCTACGCGTCGTCTGCTCTCGTAGCATCGGCTCAACC
GGCCTCCTGGAGCGTGAGAACGCGACGATTCTGAACGCGGCCATCCTTCGCACCGCCCGTCACGTCAAGCGTGGC
TTCAGACGCGCCATGGGCCGTCTCCGTCTGCGTTGTCCCTTGTTTCTGTCGCAGAATGACGGCACGCTCATCGAC
GCCGACGTCGCCGCCGAGCTGCCCATCAAGACTTTTGCCAGCGGGCCGACCAACAGTATGACGGGCGCCGCCTTT
CTAGCCGGCATCGACCGCGCTGCCCCCGCTGCCGACGCCGAGGGCCCCCAGGTGCTGGTGGTGGACATTGGCGGC
ACTACGACGGACATCTGCGCCCTGCTACCCTCGGGCTTCCCCCGTCAGGCACCGGGCTTCGTCGACGTCGGCGGG
GTCCGGACCGCTTTTTCTATGCCCGAGGTCCTCTCCGTCGGTCTCGGCGGCGGAAGCAAAGTGGTCGTGACGCCG
GACCCACACCGGCCCGGCTTCGACCTCGTCTCCGTCGGCCCGGCCTCGGTCGGCCACCGGCTCCGGGAGGAGGCC
CGCGTCTTCGGCGGATCGACGCTGACGGCAACCGACGCCATCGCGGCCGCCGGCGGCAATGACCTCGGCGACGCC
GCCCTCGTCGCCGACGTACCCCGGACCACCATTGACCTCGCCTGCCAAGACATACGGCACAAGCTCGAGACCATC
ATCGACCGTATGAGGGTCTCTGCCGCGCCTGTCCACGTGCTACTCGTCGGTGGCGGCGCCATCCTCGTCAGGGAA
GAGCTGGCCGGTGTGGACAAGTGCATCCGTCCCGTTCATCAGGGCGCGGCCAACGCCGTCGGAGCGGCCATCGCA
AAGGTCTCGGGCGAGGTCGATAGTCTCGAGATTTTGGGCCGTAGGCAAGAGAGGGAGATTATCGACGCTGCCTGC
AGCCGTGCTGTCGACCTGGCCGTCGAAAAGGGCGCCAGCCGTGACGACGTACGAGTCGTCGAGATCAATAAGACG
CCTCTTCAGTACATGTCGCAGGAGACGATCCGCATCCAGGTCCGCGCCGTCGGTAAGCTCGCCATCCCGGTCGGC
CCTGCTCCGAGCCGGTCAAGTGCTGGAGATGCGGAGCCTCCGGTGACGGGCGAGGCCGACGACGACCGAGACGAA
GATGATGATGACGACAACGACGACGCACCCAAGGTCAGCATCCCCGACGCCCTAGAACCAACCACCAAGCCGACG
CTCGGCGTGGACCTGGCCACATACCGGCCGGACGTCCGTGCCGGCGTCTGGTACGTGTCCGAGATCGATCTTGAG
CTCATCGCCACCGGCTGCGGCGTCCTCGGCACCGGCGGCGGCGGCCCGACTTACTACGAGTATCTCAAGTGTCTC
AACAGCCGTCGCGGACCGGGCGGTGACAAGATGAGGATCATCTCGGCCCAGTCGCTCGCCGACGACGACGTCGTC
TGCTTCGGCGCCTGGTACGGCAGTCCGAGCGTCATCAACGAGCGTATCCCGGGCGGCAACGAGATCGCCGCTGCC
ATCGACGCCGTTAATCTCATCAAGGGGAACGACTCCTTTGCCGCTCTCTGCCTCGACGAGATGTACGTCTTGAGT
TTTTTTACCCCAGCTTTTGGCATCCTGAGCCCCTGACCCCCCTAACTGACTCGGCCAACCCCCATCCCAGCGGAG
GCGGCAACGGCATGTGTGCCTTGCCCAATTGCGTACGCTACGACTGCCCCGTAATCGACGGCGATGCCATGGGAC
GAGCCTATCCAACCCTGTACCACAGTGAGTCCTTGGCCTTATCCGAGCCCGTCTAGGCTTTTCTCCCTGACGTCG
AGAAGCCAGCTTCTGCGTCTACGGCTACAGCATGACGCCTTGTACCGTCACAGATGCCGCCGGCAACGTCGTCGT
GGCTACCGTGCGTTTCCCTTCCCCCCCCCCCTTTCTCTACATGGCTCCAAGCAAACAGCCGGCTGATGCAAAAGG
CAGAAAACCGATAACCCCTTCCGCCTCGAGACGCTCATCCGAACGGCATCCGTCGAGATGGGCTTGTCGTGCGCA
TCGAGTCCTAATCCGCTTCCAGCATCGGCCGTCAAGGCGCATGGCGTGCCAAACACCATATCGCAGGCCTGGTAT
CTGGGCCGAGCTGTGCACATGGCCAGGCGTAGTAAGGCGAACTATGTAGATGCCATTGTAAGTGCTCGTCTGTAT
CTGTCTCTTCTTGTTCTCTTTGCTCTTTATCAAGTGCTCGTCACTGCCTAATCCTCTTCGTCTTCCTCCGTCTTC
GCATTCTTCGATTTCTTACTCAGTTTCCTCCTTCCCCTGATTTTCCTTTCCGTTTATATGCATTCCTTAGTTCTT
CCTGGACCTTGTTTCTTCTCTGTGCATTCCCCCCCCCCCCTTTTTATGCCTTCTTTCTTTCTTCCTTGTTTTTCT
CTTTCCATCTCTTTCCGACTCCATTTCTGTGTTATTTCTTCCCCTCCACCGCTGACTCGAGTAGTTCAGCGTCTG
CGACGGAAAGCTGCTCTTCACGGGGAAGATCACCGACGTCCACCGCTATATCGGCGGCGGGTATACCATGGGCGC
CGTCCTGCTCGCCCCTCTGAGTGACGAGGAGCGCGAATCGCCAGCCAACGCCAGCCGCCAACAAGTCCCAACAGA
CAAGCACATGATCATTCCGTTCCAGAACGAGTATCTGTACGCCGCTCACTGCGATGCACTGGGATCCGAGCCGTC
GAGGGAGGTCGTATGCACCGTCCCGAGTCTCATCTCCATCTTGGGCCAAGACGGCGAGGCCATTGGATCTCAAGA
CTTGCGGTACGGTCTCCGCGTCAACGTCATCGCCCTGCCGGCGCATCCGCTATGGCGAACTCCGGAAGCACTGAA
GGTAGGTGGCCCGGAGGGCTTCGGCTTGAACATGCCCGAAGTCGGTGTCGAGACGTGCGAAGAGTTTAAGGGGGC
AAGGAGCGTCATAGACGAATTTAGGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail