Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7064
Gene name
Locationscaffold_655:4937..6864
Strand-
Gene length (bp)1927
Transcript length (bp)1875
Coding sequence length (bp)1872
Protein length (aa) 624

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3 6.7E-23 15 93
PF13181 TPR_8 Tetratricopeptide repeat 1.4E-02 139 168
PF13432 TPR_16 Tetratricopeptide repeat 1.0E-03 501 543
PF13374 TPR_10 Tetratricopeptide repeat 1.6E-03 461 490

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41889|CUT9_SCHPO Anaphase-promoting complex subunit cut9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut9 PE=1 SV=2 2 610 2.0E-171
sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC16 PE=1 SV=1 1 549 2.0E-129
sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 1 541 4.0E-87
sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=1 SV=1 5 541 2.0E-85
sp|B3DNN5|CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana GN=APC6 PE=2 SV=1 5 549 1.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41889|CUT9_SCHPO Anaphase-promoting complex subunit cut9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut9 PE=1 SV=2 2 610 2.0E-171
sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC16 PE=1 SV=1 1 549 2.0E-129
sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 1 541 4.0E-87
sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=1 SV=1 5 541 2.0E-85
sp|B3DNN5|CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana GN=APC6 PE=2 SV=1 5 549 1.0E-84
sp|Q1ZXE6|CDC16_DICDI Anaphase-promoting complex subunit 6 OS=Dictyostelium discoideum GN=anapc6 PE=3 SV=1 252 451 5.0E-34
sp|G5EG38|CDC16_CAEEL Cell division cycle protein 16 homolog OS=Caenorhabditis elegans GN=emb-27 PE=1 SV=1 250 543 4.0E-25
sp|P17885|BIMA_EMENI Protein bimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimA PE=2 SV=1 290 541 4.0E-07
sp|O94556|APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut23 PE=1 SV=2 140 490 2.0E-06
sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens GN=CDC27 PE=1 SV=2 8 198 2.0E-06
sp|A7Z061|CDC27_BOVIN Cell division cycle protein 27 homolog OS=Bos taurus GN=CDC27 PE=2 SV=1 241 505 6.0E-06
sp|Q1ZXE6|CDC16_DICDI Anaphase-promoting complex subunit 6 OS=Dictyostelium discoideum GN=anapc6 PE=3 SV=1 138 242 7.0E-06
sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens GN=CDC27 PE=1 SV=2 241 505 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5038 0.7025 0.0361 0.0299 0.1314 0.0033 0.2706 0.1816 0.2134 0.0087

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4004
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2662
Ophiocordyceps australis map64 (Brazil) OphauB2|1613
Ophiocordyceps camponoti-floridani Ophcf2|05850
Ophiocordyceps camponoti-rufipedis Ophun1|3279
Ophiocordyceps kimflemingae Ophio5|7064 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8036

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7064
MERFLRDWRQDALNKAQYESAIFIGDKLLALTKDDQDAFWLAQVHFATGNYTRAQSFLAKQDLVTRSPSCRYLAG
HCLIKQNRFDDALNVLGERNPTHLISNGASNKRKAQTRHVRPRNHDGGHGGDAGSAVNRRFEAAMCFLRGICYAK
QNAFDRAKECYKDAVRIDVQCFEAFQQLMKNSLLSPDEEWHFLESLDFDAINVFGDVSSSQEAADFTKMLYTTRL
SKYRNPAAFETAYDSLSTHYHLAANPDLQLARADLLYTQCRYRDALAVTSAVLHDDKYNFSVYPVHLACLYELKM
KNLLFLVAHDLADTHPEEPCTWLAVGIYYLVIDKIPEARRYFSKASMMDAHFGPAWIGFAHTFAAEGEHDQAISA
YSTAARLFMGTHLPQVFLGMQNHALNNMTLAEEFLKTAYGLCKTDPLLLNEMGIVKYHQDKPKEAVQYFSAALKM
ADEIDSEPSAWLSARTNLGHAYRRLRHFNRALAEFDEVLRLGGKDAAIFSAKGLILMEQNRPDEAVGVLHQALAI
SPQDGIATELLNRALEETALEEVDDADDELAEFEQQLERSKAEATRRLNGGGGVDKKGKGRQGVLSEEEEEEEEE
EEEEEEVEEEDEQGESPMEMTDDE
Coding >Ophio5|7064
ATGGAAAGATTCTTGAGGGACTGGAGGCAGGATGCCCTCAACAAAGCGCAGTACGAATCCGCCATCTTTATCGGC
GACAAGCTGCTCGCCCTGACCAAGGACGATCAGGATGCCTTCTGGCTGGCCCAGGTTCATTTCGCTACCGGCAAT
TATACCCGCGCCCAGTCTTTTCTCGCCAAGCAAGACCTAGTCACCCGCAGTCCGTCTTGTCGATATCTGGCCGGC
CACTGTCTCATCAAGCAGAATCGCTTCGACGACGCGCTCAACGTCCTCGGCGAGCGGAACCCGACGCACCTCATC
TCTAACGGAGCGAGTAACAAGCGCAAGGCTCAGACGCGCCACGTTCGTCCTAGGAATCACGATGGTGGCCATGGC
GGCGACGCCGGTAGCGCTGTTAATCGCCGCTTCGAGGCCGCCATGTGCTTCCTTCGCGGCATCTGCTACGCCAAG
CAAAACGCCTTCGATCGCGCAAAGGAGTGCTACAAGGATGCGGTTCGAATCGACGTCCAATGCTTCGAGGCCTTC
CAGCAGCTCATGAAGAATTCGCTACTATCGCCCGACGAGGAGTGGCACTTTCTCGAGAGCCTCGACTTTGATGCC
ATCAACGTCTTCGGCGACGTCTCGTCCTCGCAGGAGGCGGCCGACTTCACCAAGATGCTCTACACGACGCGCCTC
TCCAAGTACCGCAACCCGGCCGCGTTCGAGACGGCCTACGACTCTCTGTCGACGCACTACCATCTGGCGGCCAAT
CCCGACCTGCAGCTCGCCCGCGCCGACCTCCTCTACACCCAATGCCGATACCGCGACGCGTTGGCGGTCACGAGC
GCCGTCCTGCACGACGACAAGTACAATTTTAGTGTATACCCCGTTCACCTCGCCTGTCTGTACGAGCTCAAGATG
AAGAACCTGTTGTTCTTGGTGGCGCACGACCTCGCCGATACGCACCCGGAGGAGCCGTGCACGTGGCTGGCCGTC
GGCATCTACTACTTGGTCATTGACAAGATCCCCGAGGCCCGGCGGTACTTTAGCAAAGCCAGCATGATGGACGCG
CACTTTGGGCCGGCCTGGATCGGCTTCGCCCACACCTTTGCCGCCGAGGGCGAACACGACCAAGCCATCTCGGCC
TACTCGACCGCCGCTCGGCTGTTCATGGGCACTCATCTGCCGCAGGTCTTTCTGGGGATGCAGAACCACGCTCTC
AACAACATGACGCTGGCCGAGGAGTTCCTCAAGACGGCCTACGGGCTGTGCAAGACGGACCCGCTACTGCTCAAC
GAGATGGGCATCGTCAAGTACCACCAGGACAAGCCCAAGGAGGCGGTGCAGTACTTTTCGGCGGCGCTCAAGATG
GCCGACGAAATTGACAGCGAGCCGTCGGCCTGGCTGTCGGCGCGGACGAATCTGGGCCACGCCTACCGGCGGCTG
CGGCACTTCAACAGGGCGTTGGCCGAGTTCGACGAGGTGCTGCGGTTGGGCGGCAAGGACGCCGCCATCTTCAGC
GCAAAGGGCCTCATCCTGATGGAGCAGAACCGGCCGGACGAGGCGGTCGGAGTGCTGCATCAAGCACTAGCCATC
AGCCCCCAAGACGGCATCGCGACGGAGCTTCTGAACAGGGCGCTGGAGGAGACGGCGCTGGAGGAGGTGGACGAT
GCCGACGACGAGCTGGCCGAATTCGAGCAGCAGCTGGAGAGGAGCAAGGCCGAGGCGACGCGGAGACTCAACGGC
GGCGGCGGCGTGGACAAGAAGGGCAAGGGACGGCAGGGCGTGCTGTCGGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGGAGGAAGAGGTAGAGGAAGAAGATGAGCAAGGCGAGAGCCCGATGGAAATGACGGATGACGAG
Transcript >Ophio5|7064
ATGGAAAGATTCTTGAGGGACTGGAGGCAGGATGCCCTCAACAAAGCGCAGTACGAATCCGCCATCTTTATCGGC
GACAAGCTGCTCGCCCTGACCAAGGACGATCAGGATGCCTTCTGGCTGGCCCAGGTTCATTTCGCTACCGGCAAT
TATACCCGCGCCCAGTCTTTTCTCGCCAAGCAAGACCTAGTCACCCGCAGTCCGTCTTGTCGATATCTGGCCGGC
CACTGTCTCATCAAGCAGAATCGCTTCGACGACGCGCTCAACGTCCTCGGCGAGCGGAACCCGACGCACCTCATC
TCTAACGGAGCGAGTAACAAGCGCAAGGCTCAGACGCGCCACGTTCGTCCTAGGAATCACGATGGTGGCCATGGC
GGCGACGCCGGTAGCGCTGTTAATCGCCGCTTCGAGGCCGCCATGTGCTTCCTTCGCGGCATCTGCTACGCCAAG
CAAAACGCCTTCGATCGCGCAAAGGAGTGCTACAAGGATGCGGTTCGAATCGACGTCCAATGCTTCGAGGCCTTC
CAGCAGCTCATGAAGAATTCGCTACTATCGCCCGACGAGGAGTGGCACTTTCTCGAGAGCCTCGACTTTGATGCC
ATCAACGTCTTCGGCGACGTCTCGTCCTCGCAGGAGGCGGCCGACTTCACCAAGATGCTCTACACGACGCGCCTC
TCCAAGTACCGCAACCCGGCCGCGTTCGAGACGGCCTACGACTCTCTGTCGACGCACTACCATCTGGCGGCCAAT
CCCGACCTGCAGCTCGCCCGCGCCGACCTCCTCTACACCCAATGCCGATACCGCGACGCGTTGGCGGTCACGAGC
GCCGTCCTGCACGACGACAAGTACAATTTTAGTGTATACCCCGTTCACCTCGCCTGTCTGTACGAGCTCAAGATG
AAGAACCTGTTGTTCTTGGTGGCGCACGACCTCGCCGATACGCACCCGGAGGAGCCGTGCACGTGGCTGGCCGTC
GGCATCTACTACTTGGTCATTGACAAGATCCCCGAGGCCCGGCGGTACTTTAGCAAAGCCAGCATGATGGACGCG
CACTTTGGGCCGGCCTGGATCGGCTTCGCCCACACCTTTGCCGCCGAGGGCGAACACGACCAAGCCATCTCGGCC
TACTCGACCGCCGCTCGGCTGTTCATGGGCACTCATCTGCCGCAGGTCTTTCTGGGGATGCAGAACCACGCTCTC
AACAACATGACGCTGGCCGAGGAGTTCCTCAAGACGGCCTACGGGCTGTGCAAGACGGACCCGCTACTGCTCAAC
GAGATGGGCATCGTCAAGTACCACCAGGACAAGCCCAAGGAGGCGGTGCAGTACTTTTCGGCGGCGCTCAAGATG
GCCGACGAAATTGACAGCGAGCCGTCGGCCTGGCTGTCGGCGCGGACGAATCTGGGCCACGCCTACCGGCGGCTG
CGGCACTTCAACAGGGCGTTGGCCGAGTTCGACGAGGTGCTGCGGTTGGGCGGCAAGGACGCCGCCATCTTCAGC
GCAAAGGGCCTCATCCTGATGGAGCAGAACCGGCCGGACGAGGCGGTCGGAGTGCTGCATCAAGCACTAGCCATC
AGCCCCCAAGACGGCATCGCGACGGAGCTTCTGAACAGGGCGCTGGAGGAGACGGCGCTGGAGGAGGTGGACGAT
GCCGACGACGAGCTGGCCGAATTCGAGCAGCAGCTGGAGAGGAGCAAGGCCGAGGCGACGCGGAGACTCAACGGC
GGCGGCGGCGTGGACAAGAAGGGCAAGGGACGGCAGGGCGTGCTGTCGGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGAGGAGGAGGAAGAGGTAGAGGAAGAAGATGAGCAAGGCGAGAGCCCGATGGAAATGACGGATGACGAGTAA
Gene >Ophio5|7064
ATGGAAAGATTCTTGAGGGACTGGAGGCAGGATGCCCTCAACAAAGCGCAGTACGAATCCGCCATCTTTATCGGC
GACAAGCTGCTCGCCCTGACCAGTCAGTCATCAACTGAGCCCCCTTTGTCCAGCCCGTTGACGACGACGCGCAGA
GGACGATCAGGATGCCTTCTGGCTGGCCCAGGTTCATTTCGCTACCGGCAATTATACCCGCGCCCAGTCTTTTCT
CGCCAAGCAAGACCTAGTCACCCGCAGTCCGTCTTGTCGATATCTGGCCGGCCACTGTCTCATCAAGCAGAATCG
CTTCGACGACGCGCTCAACGTCCTCGGCGAGCGGAACCCGACGCACCTCATCTCTAACGGAGCGAGTAACAAGCG
CAAGGCTCAGACGCGCCACGTTCGTCCTAGGAATCACGATGGTGGCCATGGCGGCGACGCCGGTAGCGCTGTTAA
TCGCCGCTTCGAGGCCGCCATGTGCTTCCTTCGCGGCATCTGCTACGCCAAGCAAAACGCCTTCGATCGCGCAAA
GGAGTGCTACAAGGATGCGGTTCGAATCGACGTCCAATGCTTCGAGGCCTTCCAGCAGCTCATGAAGAATTCGCT
ACTATCGCCCGACGAGGAGTGGCACTTTCTCGAGAGCCTCGACTTTGATGCCATCAACGTCTTCGGCGACGTCTC
GTCCTCGCAGGAGGCGGCCGACTTCACCAAGATGCTCTACACGACGCGCCTCTCCAAGTACCGCAACCCGGCCGC
GTTCGAGACGGCCTACGACTCTCTGTCGACGCACTACCATCTGGCGGCCAATCCCGACCTGCAGCTCGCCCGCGC
CGACCTCCTCTACACCCAATGCCGATACCGCGACGCGTTGGCGGTCACGAGCGCCGTCCTGCACGACGACAAGTA
CAATTTTAGTGTATACCCCGTTCACCTCGCCTGTCTGTACGAGCTCAAGATGAAGAACCTGTTGTTCTTGGTGGC
GCACGACCTCGCCGATACGCACCCGGAGGAGCCGTGCACGTGGCTGGCCGTCGGCATCTACTACTTGGTCATTGA
CAAGATCCCCGAGGCCCGGCGGTACTTTAGCAAAGCCAGCATGATGGACGCGCACTTTGGGCCGGCCTGGATCGG
CTTCGCCCACACCTTTGCCGCCGAGGGCGAACACGACCAAGCCATCTCGGCCTACTCGACCGCCGCTCGGCTGTT
CATGGGCACTCATCTGCCGCAGGTCTTTCTGGGGATGCAGAACCACGCTCTCAACAACATGACGCTGGCCGAGGA
GTTCCTCAAGACGGCCTACGGGCTGTGCAAGACGGACCCGCTACTGCTCAACGAGATGGGCATCGTCAAGTACCA
CCAGGACAAGCCCAAGGAGGCGGTGCAGTACTTTTCGGCGGCGCTCAAGATGGCCGACGAAATTGACAGCGAGCC
GTCGGCCTGGCTGTCGGCGCGGACGAATCTGGGCCACGCCTACCGGCGGCTGCGGCACTTCAACAGGGCGTTGGC
CGAGTTCGACGAGGTGCTGCGGTTGGGCGGCAAGGACGCCGCCATCTTCAGCGCAAAGGGCCTCATCCTGATGGA
GCAGAACCGGCCGGACGAGGCGGTCGGAGTGCTGCATCAAGCACTAGCCATCAGCCCCCAAGACGGCATCGCGAC
GGAGCTTCTGAACAGGGCGCTGGAGGAGACGGCGCTGGAGGAGGTGGACGATGCCGACGACGAGCTGGCCGAATT
CGAGCAGCAGCTGGAGAGGAGCAAGGCCGAGGCGACGCGGAGACTCAACGGCGGCGGCGGCGTGGACAAGAAGGG
CAAGGGACGGCAGGGCGTGCTGTCGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAAGAGGTAGA
GGAAGAAGATGAGCAAGGCGAGAGCCCGATGGAAATGACGGATGACGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail