Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7062
Gene name
Locationscaffold_654:8053..9324
Strand+
Gene length (bp)1271
Transcript length (bp)699
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 3.8E-04 15 31
PF00098 zf-CCHC Zinc knuckle 2.5E-03 36 51
PF00098 zf-CCHC Zinc knuckle 3.6E-05 60 75
PF00098 zf-CCHC Zinc knuckle 2.0E-08 87 102
PF00098 zf-CCHC Zinc knuckle 8.9E-07 138 153
PF00098 zf-CCHC Zinc knuckle 2.4E-07 158 173
PF00098 zf-CCHC Zinc knuckle 7.3E-08 185 202
PF14392 zf-CCHC_4 Zinc knuckle 2.7E-01 14 31
PF14392 zf-CCHC_4 Zinc knuckle 1.7E+00 35 51
PF14392 zf-CCHC_4 Zinc knuckle 3.9E+00 61 75
PF14392 zf-CCHC_4 Zinc knuckle 1.9E+00 88 102
PF14392 zf-CCHC_4 Zinc knuckle 6.3E-01 159 173
PF14392 zf-CCHC_4 Zinc knuckle 8.8E-01 185 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 12 202 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 11 207 9.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 200 2.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 201 3.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 84 204 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 12 202 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 11 207 9.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 200 2.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 201 3.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 84 204 3.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 84 204 3.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 84 204 3.0E-18
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 12 200 4.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 12 200 4.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 12 200 4.0E-18
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 12 200 5.0E-18
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 37 207 6.0E-18
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 12 200 6.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 12 200 7.0E-18
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 16 177 2.0E-17
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 84 204 5.0E-17
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 84 204 3.0E-16
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 6 173 7.0E-16
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 6 173 7.0E-16
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 6 173 7.0E-16
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 6 173 9.0E-16
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 84 204 3.0E-15
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 6 173 3.0E-15
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 6 173 2.0E-14
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 37 203 4.0E-14
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 55 210 9.0E-14
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 156 2.0E-13
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 17 174 2.0E-13
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 88 209 4.0E-13
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 85 202 1.0E-12
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 6 107 4.0E-12
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 6 107 4.0E-12
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 6 107 4.0E-12
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 6 107 5.0E-12
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 75 200 1.0E-11
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 15 107 2.0E-11
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 73 223 3.0E-11
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 15 107 4.0E-11
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 88 201 5.0E-11
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 88 205 5.0E-11
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 2 101 2.0E-10
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 88 223 2.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 22 102 3.0E-10
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 88 206 4.0E-10
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 9 103 8.0E-10
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 61 203 2.0E-09
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 73 206 2.0E-09
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 16 101 3.0E-09
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 139 206 3.0E-09
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 139 206 6.0E-09
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 73 206 6.0E-09
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 139 206 7.0E-09
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 88 206 7.0E-09
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 73 206 8.0E-09
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 139 206 8.0E-09
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 127 206 9.0E-09
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 139 217 1.0E-08
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 73 206 1.0E-08
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 88 206 1.0E-08
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 73 206 1.0E-08
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 84 202 2.0E-08
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 88 206 2.0E-08
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 139 206 2.0E-08
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 139 206 2.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 88 206 2.0E-08
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 88 172 2.0E-08
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 88 204 3.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 127 206 3.0E-08
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 144 205 3.0E-08
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 139 206 3.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 73 206 3.0E-08
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 127 206 3.0E-08
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 133 201 4.0E-08
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 60 203 4.0E-08
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 88 183 4.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 127 206 4.0E-08
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 73 206 5.0E-08
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 88 221 5.0E-08
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 144 230 6.0E-08
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 139 205 6.0E-08
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 73 173 7.0E-08
sp|Q9QC00|GAG_HV197 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 88 206 7.0E-08
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 123 212 7.0E-08
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 144 205 8.0E-08
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 88 223 9.0E-08
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 153 220 9.0E-08
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 12 180 1.0E-07
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 73 173 1.0E-07
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 129 205 1.0E-07
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 139 205 1.0E-07
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 153 224 1.0E-07
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 17 75 2.0E-07
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 145 227 2.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 35 172 2.0E-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 88 232 2.0E-07
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 88 173 3.0E-07
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 101 206 3.0E-07
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 145 205 3.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 127 200 3.0E-07
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 17 104 3.0E-07
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 88 206 4.0E-07
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 88 200 4.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 154 211 4.0E-07
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 88 206 4.0E-07
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 73 173 5.0E-07
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 88 224 5.0E-07
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 73 173 6.0E-07
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 88 173 6.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 139 176 6.0E-07
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 88 183 6.0E-07
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 139 224 6.0E-07
sp|Q8AII2|GAG_SIVTN Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 88 227 6.0E-07
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 130 223 6.0E-07
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 88 224 6.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 37 175 6.0E-07
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 88 224 7.0E-07
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 153 224 7.0E-07
sp|Q9WC62|GAG_HV1S9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag PE=1 SV=3 88 224 7.0E-07
sp|Q9WC53|GAG_HV1S2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag PE=3 SV=3 88 224 7.0E-07
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 88 215 8.0E-07
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 73 173 8.0E-07
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 73 173 8.0E-07
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 88 173 9.0E-07
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 139 224 9.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 15 108 1.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 139 206 1.0E-06
sp|O12157|GAG_HV192 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag PE=3 SV=3 88 206 1.0E-06
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 88 208 1.0E-06
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 73 173 2.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 54 210 2.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 139 206 2.0E-06
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 139 200 2.0E-06
sp|P12494|GAG_HV1J3 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 153 224 2.0E-06
sp|P20889|GAG_HV1OY Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag PE=3 SV=3 88 206 2.0E-06
sp|O93182|GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 153 224 2.0E-06
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 155 230 2.0E-06
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 138 220 2.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 145 224 2.0E-06
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 88 205 3.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 37 87 3.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 88 172 3.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 88 224 3.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 88 224 3.0E-06
sp|P03349|GAG_HV1A2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag PE=1 SV=3 153 224 3.0E-06
sp|P12498|POL_HV1J3 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 153 206 3.0E-06
sp|P04594|GAG_HV1MA Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag PE=3 SV=3 139 224 3.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 73 183 4.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 139 206 4.0E-06
sp|P04591|GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag PE=1 SV=3 88 224 4.0E-06
sp|P12493|GAG_HV1N5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag PE=1 SV=3 153 206 4.0E-06
sp|P20873|GAG_HV1JR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag PE=3 SV=3 153 224 4.0E-06
sp|O89291|GAG_HV193 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag PE=3 SV=3 139 206 4.0E-06
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 73 173 5.0E-06
sp|P19504|GAG_SIVSP Gag polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag PE=3 SV=1 129 227 5.0E-06
sp|P03347|GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 153 224 5.0E-06
sp|P19558|GAG_BIV29 Gag polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag PE=1 SV=2 48 204 6.0E-06
sp|P04590|GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag PE=1 SV=3 145 227 6.0E-06
sp|P20874|GAG_HV2ST Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag PE=3 SV=3 153 231 6.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 88 183 7.0E-06
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 88 224 7.0E-06
sp|P05888|GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag PE=1 SV=3 88 206 7.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 88 189 7.0E-06
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 105 8.0E-06
sp|P12495|GAG_HV1Z2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag PE=1 SV=3 139 224 8.0E-06
sp|P12450|GAG_HV2SB Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag PE=3 SV=3 148 205 8.0E-06
sp|P04592|GAG_HV1EL Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag PE=3 SV=3 139 206 8.0E-06
sp|P18800|GAG_HV1ND Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag PE=3 SV=3 88 206 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 198.18 107.78 288.58
CcL In ants, during behavior modification 218.60 119.19 318.01
CcD In ants, recently dead 232.70 125.70 339.69

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.710532 no
SC16a CcD 0.525078 no
CcL CcD 0.817388 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7062
MFRTSIAVMSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNGCPLPRTTEAKQCYHCQGLGHVQADCP
TLRLTGNPTSGRCYNCGQPGHLARMCPTPVAAMGRGAPMVARGGYAPAFNRGAAFTGGPRPATCYKCGGPNHFAR
DCQAQAMKCYACGKLGHISRDCTAPNGGPLNTVGKTCYQCGEAGHISRDCPQKNANGEMPPEVDLGTVPAPPAPV
APIAPVA
Coding >Ophio5|7062
ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC
TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT
CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG
ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG
TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC
CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC
GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC
AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT
CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG
GCTCCCATCGCCCCCGTGGCA
Transcript >Ophio5|7062
ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC
TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT
CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG
ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG
TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC
CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC
GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC
AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT
CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG
GCTCCCATCGCCCCCGTGGCATAA
Gene >Ophio5|7062
ATGTTCAGGTATGTTTGCCCTCAAATCTAGTTCTTCGTCACTCCTCGTCCGTCCGTCTCCCCCGTGTGCCGACTT
TTGCTGGTCTCTGCGAAACCGGCCTGCGACGCGCGCCGACGGGCCCAGATGGAGACTGCGACTGTTGATGACGCG
GCGCCGAATTCGGCTCCATGGTCGTTTTGCGCGCTTGACGACGTCGTTGACAATGCCTGCGACTGTTTGGCATTC
GTCTGGCTGGCTGGGACGTTATCTGCAATGGGATGCGCGCCCTTTTGTACGAGGGATCGCCTGACGTCGCACGAC
ATTCGGCCGTTCTTCCAGTCTCGGCTTTTGCCGCCATGGAAAGAATAAGAGGCATACGACAAAGACACGCGGGCG
GCAATGAGGAGTGACGTAGGCATCGCATCGCATCGCGGGGCCCGTTGGCTGACGAGTCTTGGGTCCTAGCAGAAC
CTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCACTATGCCGAAGT
CTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGTCTCTCCCTCCCTCTCCGGCCATCACCTTCAACAAACC
GGCTGACTCTCCTCGCTTCGCAGGCAAGCAACCTGGCCACGAGTCCAACGGCTGTCCGCTGCCCCGCACGACCGA
GGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCGACGCTTCGTCTGACCGGAAA
CCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCGTACGCGCCCGATGATGCCCCCTCTT
CCCCCCTCGGCGCATTCATTTGGCTGACTTGTTCTTCTCAGCGCATGTGTCCTACCCCCGTCGCCGCCATGGGCC
GCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAACCGTGGCGCCGCCTTCACCGGTGGCCCTC
GTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGCGATTGTCAGGCCCAGGCCATGAAGTGCT
ATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCCAACGGCGGCCCCTTGAACACTGTCGGCA
AGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGTCCTCAGAAGAACGCCAACGGCGAGATGC
CGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTGGCTCCCATCGCCCCCGTGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail