Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7062
Gene name
Locationscaffold_654:8053..9324
Strand+
Gene length (bp)1271
Transcript length (bp)699
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 3.8E-04 15 31
PF00098 zf-CCHC Zinc knuckle 2.5E-03 36 51
PF00098 zf-CCHC Zinc knuckle 3.6E-05 60 75
PF00098 zf-CCHC Zinc knuckle 2.0E-08 87 102
PF00098 zf-CCHC Zinc knuckle 8.9E-07 138 153
PF00098 zf-CCHC Zinc knuckle 2.4E-07 158 173
PF00098 zf-CCHC Zinc knuckle 7.3E-08 185 202
PF14392 zf-CCHC_4 Zinc knuckle 2.7E-01 14 31
PF14392 zf-CCHC_4 Zinc knuckle 1.7E+00 35 51
PF14392 zf-CCHC_4 Zinc knuckle 3.9E+00 61 75
PF14392 zf-CCHC_4 Zinc knuckle 1.9E+00 88 102
PF14392 zf-CCHC_4 Zinc knuckle 6.3E-01 159 173
PF14392 zf-CCHC_4 Zinc knuckle 8.8E-01 185 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 12 202 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 11 207 9.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 200 2.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 201 3.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 84 204 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 12 202 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 11 207 9.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 200 2.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 201 3.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 84 204 3.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 84 204 3.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 84 204 3.0E-18
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 12 200 4.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 12 200 4.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 12 200 4.0E-18
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 12 200 5.0E-18
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 37 207 6.0E-18
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 12 200 6.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 12 200 7.0E-18
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 16 177 2.0E-17
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 84 204 5.0E-17
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 84 204 3.0E-16
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 6 173 7.0E-16
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 6 173 7.0E-16
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 6 173 7.0E-16
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 6 173 9.0E-16
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 84 204 3.0E-15
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 6 173 3.0E-15
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 6 173 2.0E-14
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 37 203 4.0E-14
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 55 210 9.0E-14
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 17 156 2.0E-13
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 17 174 2.0E-13
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 88 209 4.0E-13
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 85 202 1.0E-12
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 6 107 4.0E-12
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 6 107 4.0E-12
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 6 107 4.0E-12
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 6 107 5.0E-12
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 75 200 1.0E-11
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 15 107 2.0E-11
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 73 223 3.0E-11
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 15 107 4.0E-11
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 88 201 5.0E-11
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 88 205 5.0E-11
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 2 101 2.0E-10
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 88 223 2.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 22 102 3.0E-10
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 88 206 4.0E-10
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 9 103 8.0E-10
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 61 203 2.0E-09
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 73 206 2.0E-09
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 16 101 3.0E-09
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 139 206 3.0E-09
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 139 206 6.0E-09
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 73 206 6.0E-09
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 139 206 7.0E-09
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 88 206 7.0E-09
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 73 206 8.0E-09
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 139 206 8.0E-09
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 127 206 9.0E-09
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 139 217 1.0E-08
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 73 206 1.0E-08
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 88 206 1.0E-08
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 73 206 1.0E-08
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 84 202 2.0E-08
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 88 206 2.0E-08
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 139 206 2.0E-08
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 139 206 2.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 88 206 2.0E-08
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 88 172 2.0E-08
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 88 204 3.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 127 206 3.0E-08
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 144 205 3.0E-08
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 139 206 3.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 73 206 3.0E-08
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 127 206 3.0E-08
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 133 201 4.0E-08
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 60 203 4.0E-08
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 88 183 4.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 127 206 4.0E-08
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 73 206 5.0E-08
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 88 221 5.0E-08
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 144 230 6.0E-08
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 139 205 6.0E-08
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 73 173 7.0E-08
sp|Q9QC00|GAG_HV197 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 88 206 7.0E-08
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 123 212 7.0E-08
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 144 205 8.0E-08
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 88 223 9.0E-08
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 153 220 9.0E-08
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 12 180 1.0E-07
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 73 173 1.0E-07
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 129 205 1.0E-07
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 139 205 1.0E-07
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 153 224 1.0E-07
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 17 75 2.0E-07
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 145 227 2.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 35 172 2.0E-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 88 232 2.0E-07
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 88 173 3.0E-07
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 101 206 3.0E-07
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 145 205 3.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 127 200 3.0E-07
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 17 104 3.0E-07
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 88 206 4.0E-07
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 88 200 4.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 154 211 4.0E-07
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 88 206 4.0E-07
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 73 173 5.0E-07
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 88 224 5.0E-07
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 73 173 6.0E-07
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 88 173 6.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 139 176 6.0E-07
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 88 183 6.0E-07
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 139 224 6.0E-07
sp|Q8AII2|GAG_SIVTN Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 88 227 6.0E-07
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 130 223 6.0E-07
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 88 224 6.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 37 175 6.0E-07
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 88 224 7.0E-07
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 153 224 7.0E-07
sp|Q9WC62|GAG_HV1S9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag PE=1 SV=3 88 224 7.0E-07
sp|Q9WC53|GAG_HV1S2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag PE=3 SV=3 88 224 7.0E-07
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 88 215 8.0E-07
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 73 173 8.0E-07
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 73 173 8.0E-07
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 88 173 9.0E-07
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 139 224 9.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 15 108 1.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 139 206 1.0E-06
sp|O12157|GAG_HV192 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag PE=3 SV=3 88 206 1.0E-06
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 88 208 1.0E-06
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 73 173 2.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 54 210 2.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 139 206 2.0E-06
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 139 200 2.0E-06
sp|P12494|GAG_HV1J3 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 153 224 2.0E-06
sp|P20889|GAG_HV1OY Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag PE=3 SV=3 88 206 2.0E-06
sp|O93182|GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 153 224 2.0E-06
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 155 230 2.0E-06
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 138 220 2.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 145 224 2.0E-06
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 88 205 3.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 37 87 3.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 88 172 3.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 88 224 3.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 88 224 3.0E-06
sp|P03349|GAG_HV1A2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag PE=1 SV=3 153 224 3.0E-06
sp|P12498|POL_HV1J3 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 153 206 3.0E-06
sp|P04594|GAG_HV1MA Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag PE=3 SV=3 139 224 3.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 73 183 4.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 139 206 4.0E-06
sp|P04591|GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag PE=1 SV=3 88 224 4.0E-06
sp|P12493|GAG_HV1N5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag PE=1 SV=3 153 206 4.0E-06
sp|P20873|GAG_HV1JR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag PE=3 SV=3 153 224 4.0E-06
sp|O89291|GAG_HV193 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag PE=3 SV=3 139 206 4.0E-06
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 73 173 5.0E-06
sp|P19504|GAG_SIVSP Gag polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag PE=3 SV=1 129 227 5.0E-06
sp|P03347|GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 153 224 5.0E-06
sp|P19558|GAG_BIV29 Gag polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag PE=1 SV=2 48 204 6.0E-06
sp|P04590|GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag PE=1 SV=3 145 227 6.0E-06
sp|P20874|GAG_HV2ST Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag PE=3 SV=3 153 231 6.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 88 183 7.0E-06
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 88 224 7.0E-06
sp|P05888|GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag PE=1 SV=3 88 206 7.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 88 189 7.0E-06
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 17 105 8.0E-06
sp|P12495|GAG_HV1Z2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag PE=1 SV=3 139 224 8.0E-06
sp|P12450|GAG_HV2SB Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag PE=3 SV=3 148 205 8.0E-06
sp|P04592|GAG_HV1EL Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag PE=3 SV=3 139 206 8.0E-06
sp|P18800|GAG_HV1ND Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag PE=3 SV=3 88 206 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7062
MFRTSIAVMSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNGCPLPRTTEAKQCYHCQGLGHVQADCP
TLRLTGNPTSGRCYNCGQPGHLARMCPTPVAAMGRGAPMVARGGYAPAFNRGAAFTGGPRPATCYKCGGPNHFAR
DCQAQAMKCYACGKLGHISRDCTAPNGGPLNTVGKTCYQCGEAGHISRDCPQKNANGEMPPEVDLGTVPAPPAPV
APIAPVA
Coding >Ophio5|7062
ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC
TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT
CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG
ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG
TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC
CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC
GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC
AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT
CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG
GCTCCCATCGCCCCCGTGGCA
Transcript >Ophio5|7062
ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC
TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT
CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG
ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG
TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC
CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC
GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC
AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT
CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG
GCTCCCATCGCCCCCGTGGCATAA
Gene >Ophio5|7062
ATGTTCAGGTATGTTTGCCCTCAAATCTAGTTCTTCGTCACTCCTCGTCCGTCCGTCTCCCCCGTGTGCCGACTT
TTGCTGGTCTCTGCGAAACCGGCCTGCGACGCGCGCCGACGGGCCCAGATGGAGACTGCGACTGTTGATGACGCG
GCGCCGAATTCGGCTCCATGGTCGTTTTGCGCGCTTGACGACGTCGTTGACAATGCCTGCGACTGTTTGGCATTC
GTCTGGCTGGCTGGGACGTTATCTGCAATGGGATGCGCGCCCTTTTGTACGAGGGATCGCCTGACGTCGCACGAC
ATTCGGCCGTTCTTCCAGTCTCGGCTTTTGCCGCCATGGAAAGAATAAGAGGCATACGACAAAGACACGCGGGCG
GCAATGAGGAGTGACGTAGGCATCGCATCGCATCGCGGGGCCCGTTGGCTGACGAGTCTTGGGTCCTAGCAGAAC
CTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCACTATGCCGAAGT
CTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGTCTCTCCCTCCCTCTCCGGCCATCACCTTCAACAAACC
GGCTGACTCTCCTCGCTTCGCAGGCAAGCAACCTGGCCACGAGTCCAACGGCTGTCCGCTGCCCCGCACGACCGA
GGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCGACGCTTCGTCTGACCGGAAA
CCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCGTACGCGCCCGATGATGCCCCCTCTT
CCCCCCTCGGCGCATTCATTTGGCTGACTTGTTCTTCTCAGCGCATGTGTCCTACCCCCGTCGCCGCCATGGGCC
GCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAACCGTGGCGCCGCCTTCACCGGTGGCCCTC
GTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGCGATTGTCAGGCCCAGGCCATGAAGTGCT
ATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCCAACGGCGGCCCCTTGAACACTGTCGGCA
AGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGTCCTCAGAAGAACGCCAACGGCGAGATGC
CGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTGGCTCCCATCGCCCCCGTGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail