Protein ID | Ophio5|7062 |
Gene name | |
Location | scaffold_654:8053..9324 |
Strand | + |
Gene length (bp) | 1271 |
Transcript length (bp) | 699 |
Coding sequence length (bp) | 696 |
Protein length (aa) | 232 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00098 | zf-CCHC | Zinc knuckle | 3.8E-04 | 15 | 31 |
PF00098 | zf-CCHC | Zinc knuckle | 2.5E-03 | 36 | 51 |
PF00098 | zf-CCHC | Zinc knuckle | 3.6E-05 | 60 | 75 |
PF00098 | zf-CCHC | Zinc knuckle | 2.0E-08 | 87 | 102 |
PF00098 | zf-CCHC | Zinc knuckle | 8.9E-07 | 138 | 153 |
PF00098 | zf-CCHC | Zinc knuckle | 2.4E-07 | 158 | 173 |
PF00098 | zf-CCHC | Zinc knuckle | 7.3E-08 | 185 | 202 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 2.7E-01 | 14 | 31 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 1.7E+00 | 35 | 51 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 3.9E+00 | 61 | 75 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 1.9E+00 | 88 | 102 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 6.3E-01 | 159 | 173 |
PF14392 | zf-CCHC_4 | Zinc knuckle | 8.8E-01 | 185 | 201 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 12 | 202 | 4.0E-44 |
sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 11 | 207 | 9.0E-33 |
sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 17 | 200 | 2.0E-25 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 17 | 201 | 3.0E-22 |
sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 84 | 204 | 3.0E-18 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 12 | 202 | 4.0E-44 |
sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 11 | 207 | 9.0E-33 |
sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 17 | 200 | 2.0E-25 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 17 | 201 | 3.0E-22 |
sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 84 | 204 | 3.0E-18 |
sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 84 | 204 | 3.0E-18 |
sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 84 | 204 | 3.0E-18 |
sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 12 | 200 | 4.0E-18 |
sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 12 | 200 | 4.0E-18 |
sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 12 | 200 | 4.0E-18 |
sp|P53996|CNBP_MOUSE | Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 | 12 | 200 | 5.0E-18 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 37 | 207 | 6.0E-18 |
sp|O42395|CNBP_CHICK | Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 | 12 | 200 | 6.0E-18 |
sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 12 | 200 | 7.0E-18 |
sp|Q8T8R1|Y3800_DROME | CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 | 16 | 177 | 2.0E-17 |
sp|P53996|CNBP_MOUSE | Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 | 84 | 204 | 5.0E-17 |
sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 84 | 204 | 3.0E-16 |
sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 6 | 173 | 7.0E-16 |
sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 6 | 173 | 7.0E-16 |
sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 6 | 173 | 7.0E-16 |
sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 6 | 173 | 9.0E-16 |
sp|O42395|CNBP_CHICK | Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 | 84 | 204 | 3.0E-15 |
sp|O42395|CNBP_CHICK | Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 | 6 | 173 | 3.0E-15 |
sp|P53996|CNBP_MOUSE | Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 | 6 | 173 | 2.0E-14 |
sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 37 | 203 | 4.0E-14 |
sp|Q8WW36|ZCH13_HUMAN | Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 | 55 | 210 | 9.0E-14 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 17 | 156 | 2.0E-13 |
sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 17 | 174 | 2.0E-13 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 88 | 209 | 4.0E-13 |
sp|Q8T8R1|Y3800_DROME | CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 | 85 | 202 | 1.0E-12 |
sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 6 | 107 | 4.0E-12 |
sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 6 | 107 | 4.0E-12 |
sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 6 | 107 | 4.0E-12 |
sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 6 | 107 | 5.0E-12 |
sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 75 | 200 | 1.0E-11 |
sp|O42395|CNBP_CHICK | Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 | 15 | 107 | 2.0E-11 |
sp|O89940|POL_HV1SE | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 | 73 | 223 | 3.0E-11 |
sp|P53996|CNBP_MOUSE | Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 | 15 | 107 | 4.0E-11 |
sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 88 | 201 | 5.0E-11 |
sp|P24740|POL_HV1U4 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 | 88 | 205 | 5.0E-11 |
sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 2 | 101 | 2.0E-10 |
sp|Q9QBZ5|POL_HV1MP | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 | 88 | 223 | 2.0E-10 |
sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 22 | 102 | 3.0E-10 |
sp|Q9QBZ9|POL_HV197 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 | 88 | 206 | 4.0E-10 |
sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 9 | 103 | 8.0E-10 |
sp|Q8T8R1|Y3800_DROME | CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 | 61 | 203 | 2.0E-09 |
sp|O12158|POL_HV192 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 | 73 | 206 | 2.0E-09 |
sp|Q8WW36|ZCH13_HUMAN | Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 | 16 | 101 | 3.0E-09 |
sp|Q9QSR3|POL_HV1VI | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 | 139 | 206 | 3.0E-09 |
sp|Q9QBZ1|POL_HV1M2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 | 139 | 206 | 6.0E-09 |
sp|P03367|POL_HV1BR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 | 73 | 206 | 6.0E-09 |
sp|Q9QBY3|POL_HV196 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 | 139 | 206 | 7.0E-09 |
sp|Q9WC54|POL_HV1S2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 | 88 | 206 | 7.0E-09 |
sp|P0C6F2|POL_HV1LW | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 | 73 | 206 | 8.0E-09 |
sp|P04588|POL_HV1MA | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 | 139 | 206 | 8.0E-09 |
sp|P04587|POL_HV1B5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 | 127 | 206 | 9.0E-09 |
sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 139 | 217 | 1.0E-08 |
sp|P20892|POL_HV1OY | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 | 73 | 206 | 1.0E-08 |
sp|Q73368|POL_HV1B9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 | 88 | 206 | 1.0E-08 |
sp|P35963|POL_HV1Y2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 | 73 | 206 | 1.0E-08 |
sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 84 | 202 | 2.0E-08 |
sp|P18802|POL_HV1ND | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 | 88 | 206 | 2.0E-08 |
sp|Q75002|POL_HV1ET | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 | 139 | 206 | 2.0E-08 |
sp|P12497|POL_HV1N5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 | 139 | 206 | 2.0E-08 |
sp|P12499|POL_HV1Z2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 | 88 | 206 | 2.0E-08 |
sp|Q02836|POL_SIVG1 | Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 | 88 | 172 | 2.0E-08 |
sp|Q8AII1|POL_SIVTN | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 | 88 | 204 | 3.0E-08 |
sp|P03369|POL_HV1A2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 | 127 | 206 | 3.0E-08 |
sp|P12451|POL_HV2SB | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 | 144 | 205 | 3.0E-08 |
sp|P04589|POL_HV1EL | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 | 139 | 206 | 3.0E-08 |
sp|P04585|POL_HV1H2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 | 73 | 206 | 3.0E-08 |
sp|P20875|POL_HV1JR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 | 127 | 206 | 3.0E-08 |
sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 133 | 201 | 4.0E-08 |
sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 60 | 203 | 4.0E-08 |
sp|P24736|GAG_HV1U4 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 | 88 | 183 | 4.0E-08 |
sp|P03366|POL_HV1B1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 | 127 | 206 | 4.0E-08 |
sp|P05961|POL_HV1MN | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 | 73 | 206 | 5.0E-08 |
sp|Q9WC63|POL_HV1S9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 | 88 | 221 | 5.0E-08 |
sp|P17757|POL_HV2D1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 | 144 | 230 | 6.0E-08 |
sp|O93215|POL_HV190 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 | 139 | 205 | 6.0E-08 |
sp|Q75002|POL_HV1ET | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 | 73 | 173 | 7.0E-08 |
sp|Q9QC00|GAG_HV197 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 | 88 | 206 | 7.0E-08 |
sp|Q9Q720|POL_HV1V9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 | 123 | 212 | 7.0E-08 |
sp|P04584|POL_HV2RO | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 | 144 | 205 | 8.0E-08 |
sp|Q9QBZ1|POL_HV1M2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 | 88 | 223 | 9.0E-08 |
sp|P20876|POL_HV2ST | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 | 153 | 220 | 9.0E-08 |
sp|Q8WW36|ZCH13_HUMAN | Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 | 12 | 180 | 1.0E-07 |
sp|Q9QBY3|POL_HV196 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 | 73 | 173 | 1.0E-07 |
sp|P19505|POL_SIVSP | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 | 129 | 205 | 1.0E-07 |
sp|O89290|POL_HV193 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 | 139 | 205 | 1.0E-07 |
sp|Q74120|POL_HV2KR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 | 153 | 224 | 1.0E-07 |
sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 17 | 75 | 2.0E-07 |
sp|P18042|POL_HV2G1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 | 145 | 227 | 2.0E-07 |
sp|O76743|GLH4_CAEEL | ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 | 35 | 172 | 2.0E-07 |
sp|Q8N567|ZCHC9_HUMAN | Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 | 88 | 232 | 2.0E-07 |
sp|P04588|POL_HV1MA | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 | 88 | 173 | 3.0E-07 |
sp|Q1A267|POL_SIVMB | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 | 101 | 206 | 3.0E-07 |
sp|P24107|POL_HV2CA | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 | 145 | 205 | 3.0E-07 |
sp|P05959|POL_HV1RH | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 | 127 | 200 | 3.0E-07 |
sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 17 | 104 | 3.0E-07 |
sp|P17283|POL_SIVCZ | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 | 88 | 206 | 4.0E-07 |
sp|Q77373|POL_HV1AN | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 | 88 | 200 | 4.0E-07 |
sp|Q82851|POL_JEMBR | Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 | 154 | 211 | 4.0E-07 |
sp|P05960|POL_HV1C4 | Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 | 88 | 206 | 4.0E-07 |
sp|P03366|POL_HV1B1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 | 73 | 173 | 5.0E-07 |
sp|P05887|GAG_HV1C4 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 | 88 | 224 | 5.0E-07 |
sp|P04587|POL_HV1B5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 | 73 | 173 | 6.0E-07 |
sp|P12497|POL_HV1N5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 | 88 | 173 | 6.0E-07 |
sp|Q82851|POL_JEMBR | Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 | 139 | 176 | 6.0E-07 |
sp|Q9QBZ6|GAG_HV1MP | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 | 88 | 183 | 6.0E-07 |
sp|Q9QBZ2|GAG_HV1M2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 | 139 | 224 | 6.0E-07 |
sp|Q8AII2|GAG_SIVTN | Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 | 88 | 227 | 6.0E-07 |
sp|O41798|POL_HV19N | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 | 130 | 223 | 6.0E-07 |
sp|Q70622|GAG_HV1LW | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 | 88 | 224 | 6.0E-07 |
sp|P34689|GLH1_CAEEL | ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 | 37 | 175 | 6.0E-07 |
sp|P03348|GAG_HV1BR | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 | 88 | 224 | 7.0E-07 |
sp|P04593|GAG_HV1B5 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 | 153 | 224 | 7.0E-07 |
sp|Q9WC62|GAG_HV1S9 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag PE=1 SV=3 | 88 | 224 | 7.0E-07 |
sp|Q9WC53|GAG_HV1S2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag PE=3 SV=3 | 88 | 224 | 7.0E-07 |
sp|Q9QSR3|POL_HV1VI | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 | 88 | 215 | 8.0E-07 |
sp|P20875|POL_HV1JR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 | 73 | 173 | 8.0E-07 |
sp|O93215|POL_HV190 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 | 73 | 173 | 8.0E-07 |
sp|O89290|POL_HV193 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 | 88 | 173 | 9.0E-07 |
sp|Q9QSR4|GAG_HV1VI | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 | 139 | 224 | 9.0E-07 |
sp|O76743|GLH4_CAEEL | ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 | 15 | 108 | 1.0E-06 |
sp|Q9QBZ6|GAG_HV1MP | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 | 139 | 206 | 1.0E-06 |
sp|O12157|GAG_HV192 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag PE=3 SV=3 | 88 | 206 | 1.0E-06 |
sp|Q8R1J3|ZCHC9_MOUSE | Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 | 88 | 208 | 1.0E-06 |
sp|P03369|POL_HV1A2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 | 73 | 173 | 2.0E-06 |
sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 54 | 210 | 2.0E-06 |
sp|Q9QBY4|GAG_HV196 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 | 139 | 206 | 2.0E-06 |
sp|Q9IDV9|POL_HV1YB | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 | 139 | 200 | 2.0E-06 |
sp|P12494|GAG_HV1J3 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 | 153 | 224 | 2.0E-06 |
sp|P20889|GAG_HV1OY | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag PE=3 SV=3 | 88 | 206 | 2.0E-06 |
sp|O93182|GAG_HV190 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 | 153 | 224 | 2.0E-06 |
sp|Q75001|GAG_HV1ET | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 | 155 | 230 | 2.0E-06 |
sp|P05962|POL_HV2NZ | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 | 138 | 220 | 2.0E-06 |
sp|P18096|POL_HV2BE | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 | 145 | 224 | 2.0E-06 |
sp|P04589|POL_HV1EL | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 | 88 | 205 | 3.0E-06 |
sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 37 | 87 | 3.0E-06 |
sp|Q02843|GAG_SIVG1 | Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 | 88 | 172 | 3.0E-06 |
sp|Q73367|GAG_HV1B9 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 | 88 | 224 | 3.0E-06 |
sp|P35962|GAG_HV1Y2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 | 88 | 224 | 3.0E-06 |
sp|P03349|GAG_HV1A2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag PE=1 SV=3 | 153 | 224 | 3.0E-06 |
sp|P12498|POL_HV1J3 | Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 | 153 | 206 | 3.0E-06 |
sp|P04594|GAG_HV1MA | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag PE=3 SV=3 | 139 | 224 | 3.0E-06 |
sp|O89939|GAG_HV1SE | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 | 73 | 183 | 4.0E-06 |
sp|O89939|GAG_HV1SE | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 | 139 | 206 | 4.0E-06 |
sp|P04591|GAG_HV1H2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag PE=1 SV=3 | 88 | 224 | 4.0E-06 |
sp|P12493|GAG_HV1N5 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag PE=1 SV=3 | 153 | 206 | 4.0E-06 |
sp|P20873|GAG_HV1JR | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag PE=3 SV=3 | 153 | 224 | 4.0E-06 |
sp|O89291|GAG_HV193 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag PE=3 SV=3 | 139 | 206 | 4.0E-06 |
sp|P05959|POL_HV1RH | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 | 73 | 173 | 5.0E-06 |
sp|P19504|GAG_SIVSP | Gag polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag PE=3 SV=1 | 129 | 227 | 5.0E-06 |
sp|P03347|GAG_HV1B1 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 | 153 | 224 | 5.0E-06 |
sp|P19558|GAG_BIV29 | Gag polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag PE=1 SV=2 | 48 | 204 | 6.0E-06 |
sp|P04590|GAG_HV2RO | Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag PE=1 SV=3 | 145 | 227 | 6.0E-06 |
sp|P20874|GAG_HV2ST | Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag PE=3 SV=3 | 153 | 231 | 6.0E-06 |
sp|Q9QBY4|GAG_HV196 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 | 88 | 183 | 7.0E-06 |
sp|Q75001|GAG_HV1ET | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 | 88 | 224 | 7.0E-06 |
sp|P05888|GAG_HV1MN | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag PE=1 SV=3 | 88 | 206 | 7.0E-06 |
sp|P15833|POL_HV2D2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 | 88 | 189 | 7.0E-06 |
sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 17 | 105 | 8.0E-06 |
sp|P12495|GAG_HV1Z2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag PE=1 SV=3 | 139 | 224 | 8.0E-06 |
sp|P12450|GAG_HV2SB | Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag PE=3 SV=3 | 148 | 205 | 8.0E-06 |
sp|P04592|GAG_HV1EL | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag PE=3 SV=3 | 139 | 206 | 8.0E-06 |
sp|P18800|GAG_HV1ND | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag PE=3 SV=3 | 88 | 206 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003676 | nucleic acid binding | Yes |
GO:0008270 | zinc ion binding | Yes |
GO:0046914 | transition metal ion binding | No |
GO:0046872 | metal ion binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0005488 | binding | No |
GO:0003674 | molecular_function | No |
GO:0043169 | cation binding | No |
GO:0043167 | ion binding | No |
GO:1901363 | heterocyclic compound binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.45 |
Transcription Factor Class (based on PFAM domains) |
---|
Zinc finger, CCHC-type |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophio5|7062 MFRTSIAVMSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNGCPLPRTTEAKQCYHCQGLGHVQADCP TLRLTGNPTSGRCYNCGQPGHLARMCPTPVAAMGRGAPMVARGGYAPAFNRGAAFTGGPRPATCYKCGGPNHFAR DCQAQAMKCYACGKLGHISRDCTAPNGGPLNTVGKTCYQCGEAGHISRDCPQKNANGEMPPEVDLGTVPAPPAPV APIAPVA |
Coding | >Ophio5|7062 ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG GCTCCCATCGCCCCCGTGGCA |
Transcript | >Ophio5|7062 ATGTTCAGAACCTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCAC TATGCCGAAGTCTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGCAACCTGGCCACGAGTCCAACGGCTGT CCGCTGCCCCGCACGACCGAGGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCG ACGCTTCGTCTGACCGGAAACCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCCGCATG TGTCCTACCCCCGTCGCCGCCATGGGCCGCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAAC CGTGGCGCCGCCTTCACCGGTGGCCCTCGTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGC GATTGTCAGGCCCAGGCCATGAAGTGCTATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCC AACGGCGGCCCCTTGAACACTGTCGGCAAGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGT CCTCAGAAGAACGCCAACGGCGAGATGCCGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTG GCTCCCATCGCCCCCGTGGCATAA |
Gene | >Ophio5|7062 ATGTTCAGGTATGTTTGCCCTCAAATCTAGTTCTTCGTCACTCCTCGTCCGTCCGTCTCCCCCGTGTGCCGACTT TTGCTGGTCTCTGCGAAACCGGCCTGCGACGCGCGCCGACGGGCCCAGATGGAGACTGCGACTGTTGATGACGCG GCGCCGAATTCGGCTCCATGGTCGTTTTGCGCGCTTGACGACGTCGTTGACAATGCCTGCGACTGTTTGGCATTC GTCTGGCTGGCTGGGACGTTATCTGCAATGGGATGCGCGCCCTTTTGTACGAGGGATCGCCTGACGTCGCACGAC ATTCGGCCGTTCTTCCAGTCTCGGCTTTTGCCGCCATGGAAAGAATAAGAGGCATACGACAAAGACACGCGGGCG GCAATGAGGAGTGACGTAGGCATCGCATCGCATCGCGGGGCCCGTTGGCTGACGAGTCTTGGGTCCTAGCAGAAC CTCTATCGCCGTCATGTCGTCTCTGTCTCGTCGTGCCTGCTACAAGTGCGGCAATGTCGGCCACTATGCCGAAGT CTGCTCGTCGGCTGAGCGGCTCTGCTACAACTGCAAGTCTCTCCCTCCCTCTCCGGCCATCACCTTCAACAAACC GGCTGACTCTCCTCGCTTCGCAGGCAAGCAACCTGGCCACGAGTCCAACGGCTGTCCGCTGCCCCGCACGACCGA GGCCAAGCAGTGCTACCACTGCCAGGGTTTGGGCCATGTCCAGGCCGACTGCCCGACGCTTCGTCTGACCGGAAA CCCGACCAGCGGCCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCCGTACGCGCCCGATGATGCCCCCTCTT CCCCCCTCGGCGCATTCATTTGGCTGACTTGTTCTTCTCAGCGCATGTGTCCTACCCCCGTCGCCGCCATGGGCC GCGGCGCGCCCATGGTCGCCCGAGGCGGATATGCCCCGGCCTTCAACCGTGGCGCCGCCTTCACCGGTGGCCCTC GTCCGGCCACATGCTACAAGTGCGGCGGTCCCAATCATTTCGCACGCGATTGTCAGGCCCAGGCCATGAAGTGCT ATGCTTGCGGCAAGCTGGGCCACATCTCGCGTGACTGCACCGCCCCCAACGGCGGCCCCTTGAACACTGTCGGCA AGACGTGCTATCAGTGCGGCGAAGCCGGTCACATCTCGAGGGACTGTCCTCAGAAGAACGCCAACGGCGAGATGC CGCCAGAGGTCGATCTGGGTACCGTCCCGGCACCGCCCGCCCCCGTGGCTCCCATCGCCCCCGTGGCATAA |